HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS		QUICK SEARCH:   [advanced] Author: Keyword(s): Year:  Vol:  Page:

This Article Full Text Full Text (PDF) Submit a Letter to Editor Alert me when this article is cited Alert me when eLetters are posted Alert me if a correction is posted Citation Map Services Email this article to a friend Similar articles in this journal Similar articles in PubMed Alert me to new issues of the journal Download to citation manager Request Permissions Citing Articles Citing Articles via HighWire Citing Articles via Google Scholar Google Scholar Articles by Fleury, Y. Articles by Delfour, A. Search for Related Content PubMed PubMed Citation Articles by Fleury, Y. Articles by Delfour, A. Social Bookmarking                      What's this?

Volume 271, Number 24, Issue of June 14, 1996 pp. 14421-14429
©1996 by The American Society for Biochemistry and Molecular Biology, Inc.

---

Covalent Structure, Synthesis, and Structure-Function Studies of Mesentericin Y 105³⁷, a Defensive Peptide from Gram-positive Bacteria Leuconostoc mesenteroides

(Received for publication, December 19, 1995, and in revised form, March 27, 1996)

Yannick Fleury , Manal Abdel Dayem ^§ , Jean Jacques Montagne ^§ , Eddy Chaboisseau , Jean Pierre Le Caer ^¶ , Pierre Nicolas ^§ and Antoine Delfour ^§

From the  Laboratoire de Biochimie des Protéines, I.B.M.I.G., Université de Poitiers, 40 Avenue du Recteur Pineau, 86022 Poitiers Cedex, France, the ^§ Laboratoire de Bioactivation des Peptides, Institut Jacques Monod, Université Paris 7, 2 Place Jussieu, 75251 Paris Cedex 05, France, and the ^¶ Laboratoire de Neurobiologie de la Diversité Cellulaire, ESPCI, 10 rue Vauquelin, 75005 Paris Cedex 05, France

A 37-residue cationic antimicrobial peptide named mesentericin Y 105³⁷ was purified to homogeneity from cell-free culture supernatant of the Gram-positive bacterium Leuconostoc mesenteroides. The complete amino acid sequence of the peptide, KYYGNGVHCTKSGCSVNWGEAASAGIHRLANGGNGFW, has been established by automated Edman degradation, mass spectrometry, and solid phase synthesis. Mesentericin Y 105³⁷ contains a single intramolecular disulfide bond that forms a 6-membered ring within the molecule. Mesentericin Y 105³⁷ was synthesized by the solid phase method. The synthetic replicate was shown to be indistinguishable from the natural peptide with respect to electrophoretic and chromatographic properties, mass spectrometry analysis, automated amino acid sequence determination, and antimicrobial properties. At nanomolar concentrations, synthetic mesentericin Y 105³⁷ is active against Gram⁺ bacteria in the genera Lactobacillus and Carnobacterium. Most interestingly, the peptide is inhibitory to the growth of the food-borne pathogen Listeria. CD spectra of mesentericin Y 105³⁷ in low polarity medium, which mimic the lipophilicity of the membrane of target organisms, indicated 30-40% -helical conformation, and predictions of secondary structure suggested that the peptide can be configured as an amphipathic helix spanning over residues 17-31. To reveal the molecular basis of the specificity of mesentericin Y 105³⁷ targetting and mode of action, NH₂- or COOH-terminally truncated analogs together with point-substituted analogs were synthesized and evaluated for their ability to inhibit the growth of Listeria ivanovii. In sharp contrast with broad spectrum -helical antimicrobial peptides from vertebrate animals, which can be shortened to 14-18 residues without deleterious effect on potency, molecular elements responsible for anti-Listeria activity of mesentericin Y 105³⁷ are to be traced at once to the NH₂-terminal tripeptide KYY, the disulfide bridge, the putative -helical domain 17-31, and the COOH-terminal tryptophan residue of the molecule. It is proposed that the amphipathic helical domain of the peptide interacts with lipid bilayers, leading subsequently to alteration of the membrane functions, whereas residues 1-14 form part of a recognition structure for a membrane-bound receptor, which may be critical for peptide targetting. Because mesentericin Y 105³⁷ is easy to synthesize at low cost, it may represent a useful and tractable tool as a starting point for the design of more potent analogs that may be of potential applicability in foods preservation.

CiteULike    Complore    Connotea    Del.icio.us    Digg    Reddit    Technorati    What's this?

This article has been cited by other articles:

				J. Rihakova, V. W. Petit, K. Demnerova, H. Prevost, S. Rebuffat, and D. Drider Insights into Structure-Activity Relationships in the C-Terminal Region of Divercin V41, a Class IIa Bacteriocin with High-Level Antilisterial Activity Appl. Envir. Microbiol., April 1, 2009; 75(7): 1811 - 1819. [Abstract] [Full Text] [PDF]

				H. S. Haugen, P. E. Kristiansen, G. Fimland, and J. Nissen-Meyer Mutational Analysis of the Class IIa Bacteriocin Curvacin A and Its Orientation in Target Cell Membranes Appl. Envir. Microbiol., November 1, 2008; 74(21): 6766 - 6773. [Abstract] [Full Text] [PDF]

				T. Tominaga and Y. Hatakeyama Development of Innovative Pediocin PA-1 by DNA Shuffling among Class IIa Bacteriocins Appl. Envir. Microbiol., August 15, 2007; 73(16): 5292 - 5299. [Abstract] [Full Text] [PDF]

				E. Salvucci, L. Saavedra, and F. Sesma Short peptides derived from the NH2-terminus of subclass IIa bacteriocin enterocin CRL35 show antimicrobial activity J. Antimicrob. Chemother., June 1, 2007; 59(6): 1102 - 1108. [Abstract] [Full Text] [PDF]

				D. Drider, G. Fimland, Y. Hechard, L. M. McMullen, and H. Prevost The Continuing Story of Class IIa Bacteriocins Microbiol. Mol. Biol. Rev., June 1, 2006; 70(2): 564 - 582. [Abstract] [Full Text] [PDF]

				T. Tominaga and Y. Hatakeyama Determination of Essential and Variable Residues in Pediocin PA-1 by NNK Scanning Appl. Envir. Microbiol., February 1, 2006; 72(2): 1141 - 1147. [Abstract] [Full Text] [PDF]

				W. Aucher, C. Lacombe, A. Hequet, J. Frere, and J.-M. Berjeaud Influence of Amino Acid Substitutions in the Leader Peptide on Maturation and Secretion of Mesentericin Y105 by Leuconostoc mesenteroides J. Bacteriol., March 15, 2005; 187(6): 2218 - 2223. [Abstract] [Full Text] [PDF]

				D. Morisset, J.-M. Berjeaud, D. Marion, C. Lacombe, and J. Frere Mutational Analysis of Mesentericin Y105, an Anti-Listeria Bacteriocin, for Determination of Impact on Bactericidal Activity, In Vitro Secondary Structure, and Membrane Interaction Appl. Envir. Microbiol., August 1, 2004; 70(8): 4672 - 4680. [Abstract] [Full Text] [PDF]

				C. Richard, D. Drider, K. Elmorjani, D. Marion, and H. Prevost Heterologous Expression and Purification of Active Divercin V41, a Class IIa Bacteriocin Encoded by a Synthetic Gene in Escherichia coli J. Bacteriol., July 1, 2004; 186(13): 4276 - 4284. [Abstract] [Full Text] [PDF]

				M. Kazazic, J. Nissen-Meyer, and G. Fimland Mutational analysis of the role of charged residues in target-cell binding, potency and specificity of the pediocin-like bacteriocin sakacin P Microbiology, July 1, 2002; 148(7): 2019 - 2027. [Abstract] [Full Text] [PDF]

				M. Limonet, A.-M. Revol-Junelles, and J.-B. Milliere Variations in the Membrane Fatty Acid Composition of Resistant or Susceptible Leuconostoc or Weissella Strains in the Presence or Absence of Mesenterocin 52A and Mesenterocin 52B Produced by Leuconostoc mesenteroides subsp. mesenteroides FR52 Appl. Envir. Microbiol., June 1, 2002; 68(6): 2910 - 2916. [Abstract] [Full Text] [PDF]

				S. Flynn, D. van Sinderen, G. M. Thornton, H. Holo, I. F. Nes, and J. K. Collins Characterization of the genetic locus responsible for the production of ABP-118, a novel bacteriocin produced by the probiotic bacterium Lactobacillus salivarius subsp. salivarius UCC118 Microbiology, April 1, 2002; 148(4): 973 - 984. [Abstract] [Full Text] [PDF]

				C. Corbier, F. Krier, G. Mulliert, B. Vitoux, and A.-M. Revol-Junelles Biological Activities and Structural Properties of the Atypical Bacteriocins Mesenterocin 52B and Leucocin B-TA33a Appl. Envir. Microbiol., April 1, 2001; 67(4): 1418 - 1422. [Abstract] [Full Text]

				D. Guyonnet, C. Fremaux, Y. Cenatiempo, and J. M. Berjeaud Method for Rapid Purification of Class IIa Bacteriocins and Comparison of Their Activities Appl. Envir. Microbiol., April 1, 2000; 66(4): 1744 - 1748. [Abstract] [Full Text]

				V. G. H. Eijsink, M. Skeie, P. H. Middelhoven, M. B. Brurberg, and I. F. Nes Comparative Studies of Class IIa Bacteriocins of Lactic Acid Bacteria Appl. Envir. Microbiol., September 1, 1998; 64(9): 3275 - 3281. [Abstract] [Full Text]

				S. Charpentier, M. Amiche, J. Mester, V. Vouille, J.-P. Le Caer, P. Nicolas, and A. Delfour Structure, Synthesis, and Molecular Cloning of Dermaseptins B, a Family of Skin Peptide Antibiotics J. Biol. Chem., June 12, 1998; 273(24): 14690 - 14697. [Abstract] [Full Text] [PDF]

				L. E.N. Quadri, L. Z. Yan, M. E. Stiles, and J. C. Vederas Effect of Amino Acid Substitutions on the Activity of Carnobacteriocin B2. OVERPRODUCTION OF THE ANTIMICROBIAL PEPTIDE, ITS ENGINEERED VARIANTS, AND ITS PRECURSOR IN ESCHERICHIA COLI J. Biol. Chem., February 7, 1997; 272(6): 3384 - 3388. [Abstract] [Full Text] [PDF]