|
Volume 271,
Number 13,
Issue of March 29, 1996 pp. 7368-7374
©1996 by The American Society for Biochemistry and Molecular Biology, Inc.
Functional
Expression of Escherichia coli Endonuclease IV in Apurinic
Endonuclease-deficient Yeast (*)
(Received for publication, November 10, 1995; and in revised form, January 17, 1996)
Dindial
Ramotar
(1),
Bruce
Demple
(2)(§)From the
(1)From CHUL, Health and Environment, RC709,
2705 Boul Laurier, Ste-Foy, Quebec, G1V 4G2 Canada, and the
(2)Department of Molecular and Cellular Toxicology,
Harvard School of Public Health, Boston, Massachusetts 02115
ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES
ABSTRACT
Saccharomyces cerevisiae Apn1 and Escherichia coli endonuclease IV are homologous enzymes that initiate the repair of
abasic (AP) sites or oxidative DNA strand breaks. Yeast lacking Apn1 (apn1 ) are hypersensitive to simple
alkylating agents (which produce many AP sites) and to oxidants and
display an elevated spontaneous mutation rate due to endogenous
damages. We explored whether the prokaryotic repair enzyme could
substitute for its yeast counterpart. Plasmid constructs were generated
that expressed endonuclease IV at 1/20 to 10-fold the AP endonuclease
activity of wild-type yeast; some of these plasmids expressed hybrid
forms of endonuclease IV equipped with the C-terminal nuclear
localization signal of Apn1. Although hybrid endonuclease IV-Apn1 (but
not native endonuclease IV) was selectively localized to the yeast
nucleus, expression of this chimeric protein at 25% of the normal Apn1
level did not restore alkylation or oxidant resistance to apn1 yeast, but it did partially counteract
the mutator phenotype of apn1 yeast.
Expression of either the hybrid protein or native endonuclease IV at
10 times wild-type Apn1 levels restored wild-type resistance to
methyl methanesulfonate and near-wild-type H 0 resistance. High level expression of native endonuclease IV also
restored the normal spontaneous mutation rate to apn1 yeast. These data place limits on the
amounts of AP endonuclease activity necessary for repair of DNA damages
caused by both endogenous and environmental agents and point to a
direct role of spontaneous AP sites as potentially mutagenic lesions.
INTRODUCTION
Ionizing radiation, chemical oxidants, and aerobic metabolism
produce toxic oxygen derivatives such as superoxide, hydrogen peroxide,
and hydroxyl radical (von Sonntag, 1987; Imlay and Linn, 1988). These
reactive oxygen species have deleterious effects, in part by producing
oxidative DNA strand breaks bearing blocked 3`-termini and various
types of oxidized abasic (AP) ( )sites (Hutchinson, 1985; von
Sonntag, 1987; Demple et al., 1986). Nonoxidized AP sites are
also formed by simple alkylating agents and spontaneous base hydrolysis
(Lindahl, 1993). Cells must repair oxidative strand breaks to allow
survival (Demple et al., 1986; Demple and Harrison, 1994) and
AP sites for survival and to prevent mutagenic errors during DNA
replication (Loeb and Preston, 1986). The repair of AP sites is
initiated by class II AP endonucleases, which make incisions on the
immediate 5` side of abasic sites (Warner et al., 1980; Demple
and Harrison, 1994). Many class II AP endonucleases also possess
3`-repair diesterase activity that selectively removes deoxyribose
fragments such as phosphoglycolate esters from the 3`-termini of
oxidatively damaged DNA (Henner et al., 1983; Johnson and
Demple, 1988ab; Levin et al., 1988; Ramotar et al.,
1991b; Demple and Harrison, 1994). Both enzymatic activities, class II
AP endonuclease and 3`-diesterase, yield free 3`-hydroxyl groups that
support DNA repair synthesis. In Escherichia coli, exonuclease
III and endonuclease IV are the main AP endonucleases that function in
cellular resistance to oxidants and alkylating agents and in limiting
spontaneous mutagenesis (Cunningham et al., 1986; Demple et al., 1986; Levin et al., 1988; Kunz et al. 1994). In Saccharomyces cerevisiae, these functions are
effected by a single enzyme, Apn1 (Ramotar et al., 1991b; Kunz et al., 1994), which is homologous to E. coli endonuclease IV (Popoff et al., 1990). Related genes have
been identified in Mycobacterium leprae (Honore et
al., 1993), Mycoplasm genitalium (Fraser et al.,
1995), and in the fission yeast Schizosaccharomyces pombe, ( )but their biological roles remain undetermined. No homolog
of exonuclease III has yet been reported for S. cerevisiae,
but exonuclease III-related enzymes have been found in mammalian cells
(Demple et al., 1991; Robson and Hickson, 1991; Robson et
al., 1991; Seki et al., 1991), Drosophila (Sander et al., 1991), plants (Babiychuk et al.,
1994), and Gram-positive bacteria (Puyet et al., 1989). The
alkylation and oxidation resistance conferred in yeast by Apn1 is due,
respectively, to efficient repair of alkylation-induced AP sites and
blocked oxidative 3`-termini in DNA (Ramotar et al., 1991b).
The mutator phenotype of Apn1-deficient (apn1- 1) strains
seems largely due to the generation of AP sites by endogenous mutagens,
with the extra mutations primarily single base pair substitutions
dominated by a 60-fold increase in the rate of AT CG
transversions (Kunz et al., 1994). Apn1 protein and
endonuclease IV share 41% amino acid identity over a region
encompassing 95% of the bacterial protein and the N-terminal 285
residues of the yeast protein (Popoff et al., 1990). In
addition, Apn1 has a C-terminal segment of 82 residues including three
clusters of basic amino acids (Popoff et al.(1990), see Fig. 1). The most C-terminal of these basic clusters of Apn1 is
required to localize Apn1 efficiently to the yeast nucleus, but not for
enzymatic activity (Ramotar et al., 1993).
Figure 1:
Schematic structures of Apn1,
endonuclease IV, and endonuclease IV derivatives. The numbers above
each bar indicate the amino acid residues. The dark shaded
areas represent the basic amino acid clusters of the Apn1 protein.
The homologous regions are residues 5-272 of endonuclease IV and
18-287 of Apn1 (Popoff et al.,
1990).
In an earlier
report, we demonstrated that Apn1 expressed in E. coli can
substitute specifically for endonuclease IV in the repair of damaged
DNA in vivo (Ramotar et al., 1991a). It thus appears
that Apn1 and endonuclease IV share in vivo substrate
specificity in DNA repair consistent with their homology and similar in vitro properties (Johnson and Demple, 1988b; Levin et
al., 1988). We show here that native E. coli endonuclease
IV can functionally substitute for Apn1 in yeast when expressed at high
but not low levels and is not localized to any specific organelle. A
derivative of endonuclease IV equipped with the distal two basic
clusters of Apn1 accumulated in the yeast nucleus and lowered the apn1- 1 mutation rate even when expressed at a lower
level.
MATERIALS AND METHODS
Strains and MediaThe APN1 S. cerevisiae strains and their respective apn1- 1 derivatives were FY86 (MATa; his3- 200, ura3-52, leu2 1, GAL2 ; kindly provided by Dr. Fred Winston,
Harvard Medical School), the isogenic DRY377 (apn1- 1::HIS3; Ramotar et al.(1993)),
MKp-o (MATa, can1-1000, ade2-1, lys2-1, ura3-52, leu2-3, 112, his3- 200, trp1- 901, GAL ; kindly provided by Dr. Bernard Kunz,
University of Manitoba), and DRY373 (apn1- 1::H1S3; Ramotar et al. (1991b)).
Yeast strains were grown in either complete YPD or the minimal
synthetic medium (SD) of Sherman et al.(1983). Nutritional
supplements were added at 20 µg/ml to SD medium. E. coli strain AB1157 (xth nfo ) was a laboratory stock (Demple et al., 1986); strain BW528 ( (xth-pnc), nfo::kan) was kindly provided by Dr. B Weiss
(University of Michigan, Ann Arbor). E. coli strain HB101
(Sambrook et al., 1989) was used for plasmid maintenance.
Construction of plac-EndoIV and plac-EndoIV*The
plasmid pRPC124 (generously provided by Dr. R. Cunningham, Albany, NY)
contains the entire coding region of the E. coli nfo gene and
the flanking 5`- and 3`-untranslated DNA sequences (Cunningham et
al., 1986). This plasmid was used as the template to amplify by
polymerase chain reaction (PCR) (Sambrook et al., 1989) the
sequence from -21 to +937 (numbering with respect to the
first A of the nfo start codon) using the primers DR1
(5`-GGGTTTAACAGGGGTACCCGCATGAAATAC-3`, start codon shown in
bold) and DR2 (5`-TTTCGTTCGGCTGGATCCGCGGGTTACGCC-3`) bearing the
restriction sites (underlined) for KpnI and BamHI,
respectively. This procedure yielded a 958-bp fragment containing the
entire nfo coding region and 150 base pairs (bp) of the
3`-untranslated region, which was digested with KpnI and BamHI and subcloned next to the lac promoter in the E. coli expression vector pKEN2 (provided by Dr. G. Verdine,
Harvard University). In this construct, 808 bp of the PCR product was
replaced by the corresponding fragment of nfo from pRPC124,
thus generating plac-Endo IV. This strategy allowed us to confirm the nfo DNA sequence by determining only the remaining 150 bp
derived from PCR. In a similar manner, plasmid plac-EndoIV* was
constructed in order to accommodate the in-frame attachment of APN1 regions (see below), except that the PCR product was generated
using the primers DR1 and DR3 (5`-TCATCTTCAGGGATCCGCTTTTTCAGTTTG-3`; BamHI site underlined). Thus, EndoIV* lacks the last two amino
acid residues of endonuclease IV and the 3`-untranslated region of the nfo gene.
Attachment of Apn1 C-terminal Basic Clusters to
Endonuclease IVThe 3` end of the APN1 gene (base pairs
+940 to +1435) was amplified by PCR using the primers DR4
(5`- GCAGAAATTGGATCCTAAATCGCGTAAGG -3`)
and DR5,
(5`- CCCGCGTTCAAGATTACAAGTA -3`)
bearing restriction sites for BamHI and SalI,
respectively. The PCR-amplified 500-bp fragment encodes Apn1 basic
clusters 2 and 1, which together span 50 amino acid residues
(317-GAKSRKEQLDKFEVKQKKRAGGTKRKKATAEPSDNDILSQMTKKRKTKKE-367;
clusters 2 and 1 are indicated in boldface type; see Fig. 1) and
329 bp of the 3`-untranslated region of APN1. After digestion
with BamHI and SalI, the fragment was subcloned into
plasmid plac-EndoIV* to produce plac-EndoIV . The in-frame
addition of Apn1 sequences was expected to yield the 333-residue hybrid
protein EndoIV (Fig. 1). Plasmid
plac-EndoIV was digested with BamHI, blunt-ended
using S1 nuclease, and digested with EcoRV to remove cluster 2
sequences precisely; the resulting linear blunt-ended fragment was
recircularized to generate plasmid plac-EndoIV , which
bears only cluster 1, fused in-frame with endonuclease IV.
Construction of Plasmids for Endonuclease IV Expression
in YeastPlasmids plac-EndoIV, plac-EndoIV*,
plac-EndoIV , and plac-EndoIV were digested
with KpnI and XhoI (sites located in the multiple
cloning site of pKEN2) to release the DNA fragment encoding
endonuclease IV and its derivatives containing Apn1 sequences. These
fragments were subcloned directly next to the GAL1 promoter in
the yeast expression vector pYES2.0 (Ramotar et al., 1993) to
produce pGAL-EndoIV, pGAL-EndoIV*, pGAL-EndoIV , and
pGAL-EndoIV . Like plac-EndoIV*, pGAL-EndoIV* also lacks
the normal stop codon such that translation is expected to terminate
within pYES2.0 sequences; this construct was predicted to encode
endonuclease IV with an additional 55 amino acid residues at the C
terminus.
Enzyme Assays and Activity GelsCrude extracts
were assayed for both AP endonuclease and 3`-diesterase activities as
described by Levin et al.(1988) and Levin and Demple(1990).
Activity gels were prepared as described by Bernelot-Moens and
Demple(1989) as modified by Ramotar et al. (1991a).
Cellular Sensitivity MeasurementsThe sensitivity
of yeast strains to hydrogen peroxide or to methyl methanesulfonate
(MMS) was measured by standard survival curves using exponential phase
cultures (Ramotar et al., 1991b) or by gradient plate assays
(Cunningham et al., 1986; Ramotar et al., 1993). In
the plates, the bottom layer (30 ml) contained 0.4 mmol (for E.
coli) or 0.13 mmol (for yeast) of MMS. For tert-butylhydroperoxide, 3.9 µmol was used in the bottom
layer (30 ml) for gradient plates with E. coli.
Mutation AssaySpontaneous mutation rates in yeast
were determined using the fluctuation test described by von
Borstel(1978). For each test, 24 independent 1-ml cultures were grown
in 24-well plates (Costar) in SD medium (Sherman et al., 1983)
with limiting concentrations of adenine (0.75 µg/ml) for ade2-1 reversion or lysine (1.0 µg/ml) for lys2-1 reversion.
The initial cell density was typically 4000 cells per ml and
reached a density of 1.0 10 cells per ml when
the adenine or lysine was exhausted. For induction of endonuclease IV,
the SD medium contained 2% galactose instead of glucose. Calculation of
the spontaneous mutation rates and experimental errors was also
according to the formulae given by von Borstel(1978).
Immunological MethodsRabbit polyclonal antibodies
specific for endonuclease IV ( )were used at a dilution of
1:1000 in 10 mM Tris-HCl (pH 7.5), 150 mM NaCl, and
4% powdered milk (Gershoni and Palade, 1983). Ten ml of this solution
was used to probe each nitrocellulose filter (8 10 cm) blotted
from SDS-polyacrylamide gels. Goat anti-rabbit IgG conjugated to
horseradish peroxidase (BIO/CAN Scientific, Inc., Ontario, Canada) was
used as the secondary antibody at a dilution of 1:5000. Immunoreactive
polypeptides were detected using 4-chloro-1-naphthol (Bio-Rad). Indirect immunofluorescence to detect endonuclease IV expressed in
yeast was performed according to Pringle et al.(1991) modified
as follows. Cells were grown overnight in 1 ml of uracil omission
medium (Sherman et al., 1983) containing 2% glucose; the
following day, the cells were washed twice, each time with 1 ml of 20
mM potassium phosphate (pH 7.0), resuspended in 1 ml of uracil
omission medium containing 2% (v/v) glycerol, and allowed to grow for 8
h at 30 °C. Cells were washed as above, resuspended in 5 ml of
uracil omission medium containing 2% galactose, and grown overnight at
30 °C to permit induction of endonuclease IV. The cells were then
fixed in 4.4% formaldehyde for 90 min at room temperature. After
fixation, the cells were permeabilized by a 20-min incubation with
zymolyase, washed twice with 1 M sorbitol, 10 mM Tris-HCl, pH 7.5, and resuspended in 50 µl of the same buffer.
Ten µl of the resulting spheroblasts was placed on a
polylysine-coated glass microscope slide and incubated overnight at
room temperature with 20 µl of anti-endonuclease IV antiserum at a
dilution of 1:1000 in 137 mM NaCl, 2.6 mM KCl, 7.9
mM Na HP0 , 1.4 mM KH PO , pH 7.3, 1 mg/ml bovine serum albumin
(PBS-BSA; Pringle et al.(1991)). The cells were then washed
for 30 min with 10 drops of PBS-BSA. RNase was added to 50 µg/ml in
a final volume of 20 µl, and the incubation continued at room
temperature for 30 min. Cells were then washed for 10 min with 5 drops
of PBS-BSA, and the secondary antibody (fluorescein-conjugated
``Affini-pure'' donkey anti-rabbit IgG (Jackson
ImmunoResearch Laboratories)) was added to the cells as 20 µl of a
1:50 dilution, and the incubation continued for 2 h at room
temperature. The cells were then washed for 1 h with 20 drops of
PBS-BSA, and 20 µl of 200 µg/ml propidium iodide was added to
each well for 10 min. Cells were then washed only twice, each time with
2 drops of PBS-BSA (excessive washing removed the propidium iodide and
weakened the DNA staining). The results were documented using a Zeiss
fluorescence microscope equipped with an Axiophot camera.
RESULTS
A plasmid was constructed to express E. coli endonuclease IV in yeast by placing the nfo gene behind
the yeast galactose-inducible GAL1 promoter in the multicopy
vector pYES2.0 (Ramotar et al., 1993). The resulting construct
(pGAL-EndoIV) was transformed into the yeast strain FY86 and its apn- 1 derivative DRY377, and the transformants were
examined for expression of AP endonuclease activity. AP endonuclease
activity was not detectable in cell-free extracts of the apn1- 1 mutant harboring the vector pYES2.0, while the
expected activity ( 60 units/mg) was seen in the APN1 strain for cells grown in either glucose
or galactose (Table 1). The plasmid pGAL-EndoIV directed the
synthesis of AP endonuclease activity in the apn1- 1 strain at 25% of the level for glucose-grown, wild-type
yeast, with an induction of 50-fold by galactose (Table 1).
Under the same conditions, plasmid pDR6 containing the APN1 gene under pGAL1 control (Ramotar et
al., 1993) gave both basal and induced AP endonuclease levels in
DR377 at 6-fold higher than observed for pGAL-Endo IV (Table 1). We do not know whether this difference reflects
differences in the synthesis or the stability of endonuclease IV and
Apn1 or a failure of the bacterial enzyme to be generated in the fully
active form in yeast. A more remote possibility is that endonuclease IV
is somehow poorly extracted from yeast cells under our conditions. The
lower induced activity of endonuclease IV in yeast extracts was not due
to the presence of an inhibitor, because the addition of purified
endonuclease IV to apn1- 1 extracts did not alter the
activity of the bacterial enzyme (data not shown).
The expression in
yeast of active, full-length endonuclease IV was confirmed by activity
gel analysis. In this approach, enzymatic cleavage of a synthetic
3`-[ P]phosphoglycoaldehyde substrate releases
the label, which then diffuses out of the gel to leave a clear band
upon autoradiography (Bernelot-Moens and Demple, 1989; Ramotar et
al., 1991a). Extracts prepared from the apn1- 1 strain failed to form a detectable band, while the presence of
plasmid pGAL-EndoIV gave rise to a clear activity band (Fig. 2, lane 3) at the position expected for endonuclease IV (lane
7). Growth of this strain in galactose allowed the endonuclease IV
activity band to be easily detected with 20-fold less protein (lane
3 versus 4). Samples of wild-type yeast (lane 1) or
strains bearing plasmid pDR6 (lanes 5 and 6) produced
bands at the position expected for Apn1 (lane 8), in
proportion to the amount of AP endonuclease activity detected in the
quantitative enzymatic assay (Table 1).
Figure 2:
Activity gel analysis of yeast extracts. Lane 1, FY86 (APN1 ), 40 µg; lane 2, DRY377 (apn1- 1), 200 µg; lane
3, DRY377/pGAL-EndoIV grown in glucose, 100 µg; lane
4, DRY377/pGAL-EndoIV grown in galactose, 5 µg; lane
5, DRY377/pDR6 grown in glucose, 20 µg; lane 6,
DRY377/pDR6 grown in galactose, 2 µg; lane 7, purified
endonuclease IV (1.0 unit); lane 8, purified Apn1 (1.0 unit).
The positions of purified Apn1 and endonuclease IV are
indicated.
Functional Complementation of Yeast apn1- 1 Mutants by E.
coli Endonuclease IVWe tested whether endonuclease IV, which
harbors both AP endonuclease and 3`-repair activities similar to Apn1,
could functionally substitute for the yeast enzyme in vivo to
provide cellular resistance to oxidative or alkylation damage. Under
noninducing conditions (growth in glucose), the apn1- 1 strain DRY377 harboring pGAL-EndoIV remained hypersensitive to
both MMS (Fig. 3A) and H O (Fig. 3C). Upon growth in galactose, however,
wild-type resistance to MMS (Fig. 3B) and
near-wild-type resistance to H O was provided by
pGAL-EndoIV. The APN1 plasmid pDR6 gave
wild-type MMS and H O resistance to the apn1- 1 strain even under noninducing conditions (Fig. 3, A and C), and this resistance was not
further enhanced by the strong overproduction of Apn1 resulting from
growth in galactose (Fig. 3, B and D). Thus,
the normal, wild-type level of Apn1 is not limiting for the repair of
either alkylation-induced AP sites or oxidative 3`-damages.
Figure 3:
Complementation of an S. cerevisiae
apn1- deletion mutant by E. coli endonuclease IV.
Exponential-phase cells grown in medium containing either glucose (A and C) or SD-galactose medium (B and D) were challenged for 60 min with the indicated
concentrations of MMS (A and B) or
H O (C and D) and plated on
YPD agar to determine the surviving fraction of cells (scored as
colony-forming units).
Yeast
cells that lack Apn1 accumulate mutations at a high rate, as measured
using two different ochre alleles, ade2-1 and lys2-1 (Ramotar et al., 1991b). Basal expression of endonuclease
IV from pGAL-Endo IV in glucose failed to suppress this mutator
phenotype (Table 2). However, pGAL-EndoIV expressed in
galactose-containing medium eliminated the excess spontaneous
mutagenesis for both the ade2-1 and the lys2-1 alleles in strain DRY373 (Table 2). It is noteworthy that
the substantial overproduction of either endonuclease IV (Table 2) or of Apn1 from pDR6 (data not shown) did not
significantly lower the spontaneous mutation rate below that of
wild-type levels. However, the results clearly indicate that
endonuclease IV can functionally replace Apn1 in repairing both the
endogenously generated DNA lesions that potentiate spontaneous
mutagenesis (Kunz et al., 1994), as well as lethal lesions
produced by treatment with exogenous DNA damaging agents.
Activity of Endonuclease IV-Apn1 Hybrid
ProteinsAlthough pGAL-EndoIV expressed active endonuclease IV
in yeast (Table 1), this level of activity was insufficient at
the basal level to substitute for Apn1 in providing resistance to the
DNA-damaging agents MMS and H O in yeast (Fig. 3, A and C). Since endonuclease IV bears
no obvious nuclear localization signal, it seemed likely that basal
expression of endonuclease IV did not yield sufficient enzyme in the
yeast nucleus to effect DNA repair; this insufficiency is evidently
overcome by the overproduction of endonuclease IV. Thus, if
endonuclease IV were modified to achieve targeting to the yeast
nucleus, basal expression of the bacterial enzyme might provide
significant capacity for DNA repair.Previously, we reported that
basic cluster 1 of the Apn1 C terminus (Fig. 1) is essential for
efficient targeting of the protein to the yeast nucleus (Ramotar et
al., 1993). We tested whether basic cluster 1, or a combination of
clusters 1 and 2, could act as nuclear transport signals for
endonuclease IV. A series of plasmids was constructed (see
``Materials and Methods'') to express various endonuclease
IV-Apn1 hybrid proteins (Fig. 1). The plasmid series
plac-EndoIV, plac-EndoIV , and plac-EndoIV were designed for expression of these hybrid proteins in E.
coli, under control of the lac promoter. When expressed
even under noninducing conditions in the AP endonuclease-deficient, lacI strain BW528, all three plasmids
directed the synthesis of substantial AP endonuclease activity (Table 3). All three plasmids also conferred resistance in strain
BW528 to both the alkylating agent MMS and the oxidant t-butyl
hydroperoxide (Fig. 4). A slightly truncated (by two residues)
endonuclease IV derivative, Endo IV*, produced during the construction
of the chimeric proteins (see ``Materials and Methods''),
also retained functional activity in E. coli (Table 3, Fig. 4).
Figure 4:
Resistance conferred by plac-EndoIV and
its derivatives in AP endonuclease-deficient E. coli. Gradient
challenge plates were prepared and scored as indicated under
``Materials and Methods.'' 100% growth corresponds to the
full length of the tested gradient. Bars 1-6 in each
panel represent the following strains: 1, AB1157/pKEN2; 2, BW528/pKEN2; 3, BW528/plac-EndoIV; 4,
BW528/plac-EndoIV*; 5, BW528/plac-EndoIV ; and 6,
BW528/plac-EndoIV .
For expression in yeast, EndoIV and
EndoIV were positioned next to the GAL1 promoter
to produce, respectively, pGAL-EndoIV and
pGAL-EndoIV (see ``Materials and Methods'').
These plasmids were transformed into the yeast apn1- 1 mutant DRY377, and the expression of endonuclease IV derivatives
was assessed by assaying AP endonuclease activity (Table 1). Both
pGAL-EndoIV and pGAL-EndoIV directed basal
AP endonuclease expression at 15-20% the level detected for
wild-type yeast and galactose-induced levels 10-fold higher than
wild-type (Table 1). The expression in yeast of endonuclease
IV and the endonuclease IV-Apn1 hybrid proteins was confirmed by
immunoblot analysis using anti-endonuclease IV polyclonal antibodies.
Extracts of strain DRY377/pGAL-EndoIV expressed a single immunoreactive
polypeptide of the same size as purified endonuclease IV (Fig. 5; compare lanes 2 and 6), while
pGAL-EndoIV gave rise to two polypeptides of 38 and
35 kDa in size (Fig. 5, lane 4); the slower
migrating polypeptide of 38 kDa was of the size predicted for
EndoIV and accounted for most of the cross-reacting
material. The cross-reacting polypeptide of 35 kDa was likely a
proteolytic fragment of EndoIV that arose during
extractions rather than an endogenous product (see below). Crude
extracts of strain DRY377/pGAL-EndoIV expressed a single
polypeptide of 31 kDa in nearly the same amount as native
endonuclease IV (Fig. 5, compare lanes 5 and 2). Since cluster 1 contains only 12 residues, this small
segment was not expected to alter the molecular size of EndoIV significantly relative to native endonuclease IV. By the same
token, immunoblotting could not establish that cluster 1 was retained
in EndoIV .
Figure 5:
Immunoblot analysis of extracts of yeast
expressing endonuclease IV and its derivatives. Lanes 1-5 contained 120 µg of crude extract protein prepared from
galactose-induced cells. Lane 1, DRY377/pYES2.0; lane
2, DRY377/pGAL-EndoIV; lane 3, DRY377/pGAL-EndoIV*; lane 4, DRY377/pGAL-EndoIV ; lane 5,
DRY377/pGAL-EndoIV ; lane 6, 5 units of purified
endonuclease IV.
Intracellular Localization of Endonuclease IV and
DerivativesThe intracellular localization of endonuclease IV
and its derivatives was determined using endonuclease IV-specific
polyclonal antibodies. Endonuclease IV encoded by plasmid pGAL-EndoIV
was not detectable under our conditions by immunofluorescence in cells
grown in glucose medium (data not shown). After growth in galactose
medium, indirect immunofluorescence staining of strain DRY377 (apn1- 1) bearing plasmid pGAL-EndoIV exhibited
cross-reacting material distributed throughout the cells (Fig. 6B) and not specifically associated with the
yeast nucleus (Fig. 6A). In contrast, strain
DRY377/pGAL-EndoIV grown in galactose contained
cross-reacting material that was preferentially localized to the yeast
nucleus (Fig. 6D). The EndoIV derivative
was not strongly concentrated in the nucleus (Fig. 6, F
versus D), which suggests that cluster 1 of Apn1 is not sufficient
for nuclear localization in yeast, assuming that the cluster remains
attached in vivo. The combination of clusters 2 and 1 of Apn1
apparently does constitute an effective, transferable nuclear
localization signal.
Figure 6:
Intracellular localization of endonuclease
IV and its derivatives in yeast. All the strains were grown in
galactose-containing SD medium. A and B, strain
DRY377/pGAL-EndoIV; C and D, strain
DRY377/pGAL-EndoIV ; E and F, strain
DRY377pGAL-EndoIV . A, C, and E show staining for DNA with propidium iodide. B, D, and F show staining with endonuclease IV-specific
polyclonal antiserum.
A gradient plate assay was used to compare the
resistance to MMS of the apn1- 1 strains expressing native
endonuclease IV and its derivatives. The apn1- 1 strain
bearing the vector pYES2.0 was hypersensitive to MMS compared to the APN1 strain in both glucose and galactose
media (Fig. 7). In glucose medium, none of the endonuclease IV
expression plasmids (pGAL-EndoIV, pGAL-EndoIV , and
pGAL-EndoIV ) provided detectable MMS resistance to the apn1- 1 strain (Fig. 7A). Thus, even
though EndoIV enters the yeast nucleus, the basal
expression of this protein (20% of wild-type yeast levels) was unable
to correct the repair defect in the Apn1-deficient strain. In contrast,
plasmid pDR6, with the APN1 gene under the control of the GAL1 promoter, provided apparently full resistance to the apn1- 1 mutant even in glucose medium (Fig. 7A, bar 6), in which Apn1 activity is
present at a level 50% higher than in wild-type yeast (Table 1).
In galactose medium, all the plasmids (except the pYES2.0 vector)
provided full MMS resistance to the apn1- 1 strain (Fig. 7B).
Figure 7:
Resistance to MMS conferred by pGAL-EndoIV
and its derivatives in yeast apn1- 1 cells. Gradient
plates were prepared and analyzed as described under ``Materials
and Methods''; ``100% growth'' corresponds to the full
length of the tested gradient. Bars 1-6 in each panel
represent the following yeast strains: 1, FY86 (APN1 )/pYES2.0; 2, DRY377 (apn1- 1)/pYES2.0; 3, DRY377/pGAL-EndoIV; 4, DRY377/pGAL-EndoIV ; 5,
DRY377/pGAL-EndoIV ; 6, DRY377/pDR6 (with the APN1 gene under control of the GAL1 promoter).
Although the basal expression of
pGAL-EndoIV did not affect cell survival in the face of
high-level damage by MMS, an effect on the apn1- 1 mutator
phenotype was observed. The uninduced level of the EndoIV hybrid protein diminished the spontaneous mutator rate in
Apn1-deficient cells >50%, while induced expression of this protein
provided a wild-type mutation rate (Table 4). The pronounced
antimutator effect of EndoIV confirms that the hybrid
protein is efficiently transported to the yeast nucleus, although some
proportion of EndoIV could remain in the cytoplasm.
DISCUSSION
The results presented here demonstrate that E. coli endonuclease IV is actively expressed in yeast and can
functionally substitute for its S. cerevisiae homolog Apn1.
Both endonuclease IV and Apn1 were shown previously to repair damaged
DNA containing AP sites and blocked 3`-termini (Levin et al.,
1988; Johnson et al., 1988ab; Ramotar et al., 1991b).
Thus, the observed substitution of yeast Apn1 by E. coli endonuclease IV is likely a direct effect of endonuclease IV
acting in vivo to repair damaged chromosomal DNA in yeast
cells. The cross-species complementation by both endonuclease IV and
Apn1 (Ramotar et al., 1991a) suggests that their dual
enzymatic activities, AP endonuclease and 3`-diesterase, were selected
and conserved during evolution. Moreover, the need for these enzymes to
repair spontaneous DNA lesions strengthens the likelihood that similar
functions will be present in more complex eukaryotic cells. The
ability of EndoIV to diminish the spontaneous mutation
rate in Apn1-deficient cells, even when expressed at only 1000
molecules per cell (Table 1), indicates that this effect occurs
via repair of major substrate(s) of the enzyme. Since the high-level
expression of either native endonuclease IV or EndoIV restored normal spontaneous mutation rates to apn1- 1 strains, a mutagenic DNA damage that is a substrate for both the
bacterial and the yeast enzyme is formed spontaneously in
vivo. A major contributor is evidently the endogenous production
of AP sites, since about half of the observed apn1- 1 mutator effect depends on a DNA glycosylase encoded by the yeast MAG1 gene (Xiao and Samson, 1993; Kunz et al., 1994).
Oxidative DNA strand breaks could still constitute potentially
mutagenic damages in vivo (Ramotar et al., 1991b),
but such a hypothesis is undermined by the recently observed ability of
the human Ape AP endonuclease to restore normal mutation rates in
Apn1-deficient yeast (Wilson et al., 1995). Ape protein
exhibits powerful AP endonuclease activity, but only weak 3`-repair
diesterase (Chen et al., 1991). Despite its active
3`-repair diesterase, endonuclease IV did not completely replace the
function of Apn1 in providing resistance to the oxidant hydrogen
peroxide, which produces a variety of DNA lesions including modified
bases, oxidized abasic sites, and single strand breaks with blocked
3`-termini (von Sonntag, 1987). One explanation for the only partial
restoration of H O resistance in yeast apn1- mutants expressing endonuclease IV is that this
agent may produce lesions in vivo that are not efficiently
repaired by endonuclease IV, but no such damage has yet been identified
(Johnson and Demple, 1988b; Levin et al., 1988; Demple and
Harrison, 1994). Recently, it has been shown that endonuclease IV
cleaves the oxidative DNA lesion -deoxyadenosine (Ide et
al., 1994), which arises by abstraction at C1` of deoxyribose and
subsequent hydrogen donation by compounds such as glutathione (von
Sonntag, 1987). A number of other DNA repair enzymes, including E.
coli exonuclease III, endonuclease III, endonuclease VIII, Fpg
glycosylase, and T4 endonuclease V do not cleave at
-deoxyadenosine, but Apn1 was not tested (Ide et al.,
1994). Other candidate oxidative lesions include deoxyribonolactone
(1`-oxidized) and deoxypentos-4-ulose (4`-oxidized) residues, the
latter actually cleaved preferentially by endonuclease IV
(Häring et al., 1994). The activity of
Apn1 against these oxidative abasic lesions is unknown. It is also
possible that partial complementation of H O resistance in apn1- 1 yeast is due to an inability
of the bacterial protein to gain access to all of the oxidative damages
present in yeast chromatin or by a failure of endonuclease IV to
mediate productive interactions with (unknown) accessory repair
proteins in yeast. E. coli endonuclease IV lacks a
eukaryotic nuclear localization signal and hence was not concentrated
in the yeast nucleus. In this study, we achieved nuclear targeting of
endonuclease IV in yeast by attaching both basic clusters 2 and 1 of
Apn1 to the bacterial protein; cluster 1 by itself was insufficient to
mediate such localization. Together with the delocalizing effect of
deleting only cluster 1 from Apn1 (Ramotar et al., 1993), this
result indicates that nuclear transport of Apn1 is achieved by a
bipartite nuclear localization signal, analogous to the native signals
reported for a variety of nuclear proteins (Robbins et al.,
1991).
FOOTNOTES
- *
- This work was supported by grant ES03926
(to B. D.) and National Science and Engineering Research Council of
Canada Grant OGP0138503 (to D. R.) The costs of publication of this
article were defrayed in part by the payment of page charges. This
article must therefore by hereby marked
``advertisement'' in accordance with 18 U.S.C.
Section 1734 solely to indicate this fact.
- §
- To whom correspondence should be addressed:
Dept. of Molecular and Cellular Toxicology, Harvard School of Public
Health, 665 Huntington Ave., Boston, MA 02115. Tel.: 617-432-3462; Fax:
617-432-0377; demple{at}mbcrr.harvard.edu.
- (
) - The abbreviations used are: AP,
apurinic/apyrimidinic; SD, minimal synthetic medium; PCR, polymerase
chain reaction; bp, base pair(s); MMS, methyl methanesulfonate;
PBS-BSA, phosphate-buffered saline-bovine serum albumin solution.
- (
) - D. Ramotar, J. Vadnais, J.-Y. Masson, and S.
Tremblay, manuscript in preparation.
- (
) - Rabbit
polyclonal antiserum specific for endonuclease IV was obtained by
sequential injections of the purified protein (Levin et al.,
1988), separated by intervals as follows: initial, 100 µg; 3-week
boost, 25 µg; 6-week boost, 25 µg. After an additional 6 weeks,
serum was isolated by standard procedures, and its specificity was
tested by immunoblotting (Sambrook et al., 1989).
ACKNOWLEDGEMENTS
We thank Dr. Michel Vincent (CHUL) for help with the
fluorescence microscopy and Drs. Marc-Eduoard Mirault and Guy Poirier
for reading the manuscript. We are grateful to Drs. R. P. Cunningham,
F. Winston, B. Kunz, G. Verdine, and B. Weiss for strains and plasmids.
REFERENCES
- Babiychuk, E., Kushnir,
S., van Montagu, M., and Iuze, D. (1994) Proc. Natl.
Acad. Sci. U. S. A. 91, 3299-3303
[Abstract/Free Full Text]
- Bernelot-Moens, C., and
Demple, B. (1989) Nucleic Acids Res. 17, 587-600
[Abstract/Free Full Text]
- Chen, D., Herman, V., and
Demple, B. (1991) Nucleic Acids Res. 19, 5907-5914
[Abstract/Free Full Text]
- Cunningham, R. P.,
Saporito, S. M., Spitzer, S. G., and Weiss, B. (1986) J. Bacteriol. 168, 1120-1127
[Abstract/Free Full Text]
- Demple, B., and Harrison,
L. (1994) Annu. Rev. Biochem. 63, 915-948
[CrossRef][Medline]
[Order article via Infotrieve]
- Demple, B., Johnson, A.
W., and Fung, D. (1986) Proc. Natl. Acad. Sci. U. S.
A. 83, 7731-7735
[Abstract/Free Full Text]
- Demple, B., Herman, T.,
and Chen, D. S. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 11450-11454
[Abstract/Free Full Text]
- Fraser, C. M., Gocayne,
J. D., White, O., Adams, M. D., Clayton, R. A., Fleischmann, R. D.,
Bult, C. J., Kerlavage, A. R., Sutton, G., Kelley, J. M., Fritschman,
J. L., Weidman, J. F., Small, K. V., Sandusky, M., Fuhrmann, J.,
Nguyen, D., Utterback, T. R., Saudek, D. M., Phillips, C. A., Merrick,
J. M., Tomb, J.-F., Dougherty, B. A., Bott, K. F., Hu, P.-C., Lucier,
T. S., Peterson, S. N., Smith, H. O., Hutchinson, C. A., III and
Venter, J. C. (1995) Science 270, 397-403
[Abstract/Free Full Text]
- Gershoni, J. M., and
Palade, G. E. (1983) Anal. Biochem. 131, 1-15
[CrossRef][Medline]
[Order article via Infotrieve]
- Häring,
M., Rüdiger, H., Demple, B., Boiteux, S., and Epe,
B. (1994) Nucleic Acids Res. 22, 2010-2015
[Abstract/Free Full Text]
- Henner, W. D., Grunberg,
S. M., and Haseltine, W. A. (1983) J. Biol. Chem. 258, 15198-15205
[Abstract/Free Full Text]
- Honore, N., Bergh, S.,
Chanteau, S., Doucet-Populaire, F., Eiglmeier, K., Garnier, T.,
Georges, C., Launois, P., Limpaiboon, T., Newton, S., Niang, K., del
Portillo, P., Ramesh, G. R., Reddi, P., Ridel, P. R., Sittisombut, N.,
Wu-Hunter, S., and Cole, S. T. (1993) Mol. Microbiol. 7, 207-214
[CrossRef][Medline]
[Order article via Infotrieve]
- Hutchinson, F. (1985) Prog. Nucleic Acids Res. Mol. Biol. 32, 115-154
[Medline]
[Order article via Infotrieve]
- Ide, H., Tedzuka, K.,
Shimzu, H., Kimura, Y., Purmal, A. A., Wallace, S. S., and Kow, Y. W. (1994) Biochemistry 33, 7842-7847
[CrossRef][Medline]
[Order article via Infotrieve]
- Imlay, J. A., and Linn,
S. (1988) Science 240, 1302-1309
[Abstract/Free Full Text]
- Johnson, A. W., and
Demple, B. (1998a) J. Biol. Chem. 263, 18009-18016
[Abstract/Free Full Text]
- Johnson, A. W., and
Demple, B. (1988b) J. Biol. Chem. 263, 18017-18022
[Abstract/Free Full Text]
- Kunz, B. A., Henson, E.
S., Roche, H., Ramotar, D., Nunoshiba, T., and Demple, B. (1994) Proc. Natl. Acad. Sci. U. S. A. 91, 8165-8169
[Abstract/Free Full Text]
- Levin, J. D., and
Demple, B. (1990) Nucleic Acids Res. 18, 5069-5075
[Abstract/Free Full Text]
- Levin, J. D., Johnson,
A. W., and Demple, B. (1988) J. Biol. Chem. 263, 8066-8071
[Abstract/Free Full Text]
- Lindahl, T. (1993) Nature 362, 709-715
[CrossRef][Medline]
[Order article via Infotrieve]
- Loeb, L. A., and
Preston, B. D. (1986) Annu. Rev. Genet. 20, 201-230
[CrossRef][Medline]
[Order article via Infotrieve]
- Popoff, S. C., Spira, A.
S., Johnson, A. W., and Demple, B. (1990) Proc. Natl.
Acad. Sci. U. S. A. 87, 4193-4197
[Abstract/Free Full Text]
- Pringle, J. R., Adams,
A. E. M., Drubin, D. G., and Haarer, B. K. (1991) Methods Enzymol. 194, 565-602
[Medline]
[Order article via Infotrieve]
- Puyet, A., Greenberg,
B., and Lacks, S. (1989) J. Bacteriol. 171, 2278-2286
[Abstract/Free Full Text]
- Ramotar, D., Popoff, S.
C., and Demple, B. (1991a) Mol. Microbiol. 5, 149-155
[Medline]
[Order article via Infotrieve]
- Ramotar, D., Popoff, S.
C., Gralla, E. B., and Demple, B. (1991b) Mol. Cell.
Biol. 11, 4537-4544
[Abstract/Free Full Text]
- Ramotar, D., Kim, C.,
Lillis, R., and Demple, B. (1993) J. Biol. Chem. 268, 20533-20539
[Abstract/Free Full Text]
- Robbins, J., Dilworth,
S. M., Laskey, R. A., and Dingwall, C. (1991) Cell 64, 615-623
[CrossRef][Medline]
[Order article via Infotrieve]
- Robson, C. N., and
Hickson, I. D. (1991) Nucleic Acids Res. 19, 5519-5523
[Abstract/Free Full Text]
- Robson, C. N., Milne, A.
M., Pappin, D. J. C., and Hickson, I. D. (1991) Nucleic Acids Res. 19, 1087-1092
[Abstract/Free Full Text]
- Sambrook, J., Maniatis, T., and Fritsch, E. (1989) Molecular Cloning: a Laboratory Manual , Cold Spring Harbor
Press, Cold Spring Harbor, NY
- Sander, M., Lowenhaupt,
K., Lane, W. S., and Rich, A. (1991) Nucleic Acids
Res. 19, 4523-4529
[Abstract/Free Full Text]
- Seki, S., Akiyama, K.,
Watanabe, S., Hatsushika, M., Ikeda, S., and Tsutsui, K. (1991) J. Biol. Chem. 266, 20797-20802
[Abstract/Free Full Text]
- Sherman, F., Fink, G., and Hicks, J. (1983) Methods
in Yeast Genetics , Cold Spring Harbor Laboratory, Cold Spring
Harbor, NY
- von Borstel,
R. C. (1978) Methods Cell Biol. 20, 1-24
[Medline]
[Order article via Infotrieve]
- von Sonntag, C. (1987) The
Chemical Basis of Radiation Biology , Taylor and Francis, London
- Warner, H. R., Demple,
B., Deutsch, W. A, Kane, C. M., and Linn, S. (1980) Proc. Natl. Acad. Sci. U. S. A. 77, 4602-4606
[Abstract/Free Full Text]
- Wilson, D. M., III,
Bennett, R. A. O., Marquis, J. C., Ansari, P., and Demple, B. (1995) Nucleic Acids Res., 23, 5027-5033
- Xiao, W., and Samson, L. (1993) Proc. Natl. Acad. Sci. U. S. A. 90, 2117-2121
[Abstract/Free Full Text]
©1996 by The American Society for Biochemistry and Molecular Biology, Inc.

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
This article has been cited by other articles:

|
 |

|
 |
 
R. Vongsamphanh, P.-K. Fortier, and D. Ramotar
Pir1p Mediates Translocation of the Yeast Apn1p Endonuclease into the Mitochondria To Maintain Genomic Stability
Mol. Cell. Biol.,
March 1, 2001;
21(5):
1647 - 1655.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
D. Ramotar, E. Belanger, I. Brodeur, J.-Y. Masson, and E. A. Drobetsky
A Yeast Homologue of the Human Phosphotyrosyl Phosphatase Activator PTPA Is Implicated in Protection against Oxidative DNA Damage Induced by the Model Carcinogen 4-Nitroquinoline 1-Oxide
J. Biol. Chem.,
August 21, 1998;
273(34):
21489 - 21496.
[Abstract]
[Full Text]
[PDF]
|
 |
|
Copyright © 1996 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|