JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Oh, E.-S.
Right arrow Articles by Couchman, J. R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Oh, E.-S.
Right arrow Articles by Couchman, J. R.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 272, Number 18, Issue of May 2, 1997 pp. 11805-11811
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Multimerization of the Cytoplasmic Domain of Syndecan-4 Is Required for Its Ability to Activate Protein Kinase C*

(Received for publication, February 14, 1997)

Eok-Soo Oh , Anne Woods and John R. Couchman Dagger

From the Department of Cell Biology and the Cell Adhesion and Matrix Research Center, University of Alabama at Birmingham, Birmingham, Alabama 35294

ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES


ABSTRACT

The transmembrane proteoglycan syndecan-4, which is a coreceptor with integrins in cytoskeleton-matrix interactions, appears to be multimerized in vivo. Both purified and recombinant core proteins form sodium dodecyl sulfate-resistant oligomers, and we now report that a synthetic peptide corresponding to the central region of syndecan-4 cytoplasmic domain (4V) also oligomerizes. The degree of oligomerization correlates with the previously reported ability to bind protein kinase C (PKC) and regulate its activity. Only multimeric recombinant syndecan-4 core protein, but not the monomeric protein, potentiated the activity of PKCalpha , and only oligomeric syndecan-4 cytoplasmic peptides were active. Changes in peptide sequence caused parallel loss of stable oligomeric status and ability to regulate a mixture of PKCalpha beta gamma activity. A synthetic peptide encompassing the whole cytoplasmic domain of syndecan-4 (4L) containing a membrane-proximal basic sequence did not form higher order oligomers and could not regulate the activity of PKCalpha beta gamma unless induced to aggregate by phosphatidylinositol 4,5-bisphosphate. Oligomerization and PKC regulatory activity of the 4V peptide were both increased by addition of N-terminal cysteine and reduced by phosphorylation of the cysteine thiol group. Concentration of syndecan-4 at sites of focal adhesion formation may enhance multimerization and both localize PKC and potentiate its activity to induce stable complex formation.


INTRODUCTION

Extracellular matrix molecules such as fibronectin regulate many cellular processes through information encoded in the ligand-receptor interaction. Fibronectin has at least two distinct classes of cell-surface receptors: integrins and heparan sulfate proteoglycans. Integrins bind at several sites, but adhesion for many cell types is primarily through the classical RGD sequence in the tenth type III repeat of the molecule (1, 2). Clustering of specific integrins by either immobilized extracellular molecules or anti-integrin antibodies has many biological effects (reviewed in Refs. 3-6). It stimulates tyrosine phosphorylation (7, 8), elevates intracellular calcium (9), activates the Na+/H+ antiporter (10), and activates phosphatidylinositol 4-phosphate 5-kinase (11) with cytoskeletal rearrangement (3, 12). Ligand-induced dimerization or oligomerization is a key event in transmembrane signaling by hormone or growth factor receptors with tyrosine kinase activity. This leads to an increase in tyrosine kinase activity, autophosphorylation of receptors, and the induction of diverse biological responses (13, 14). Although integrins have no intrinsic tyrosine kinase activity, it is clear that their clustering is needed prior to subsequent tyrosine phosphorylation events (reviewed in Refs. 3-6). In addition, integrin-associated kinase(s) has been identified (15, 16).

Interactions between integrins and the cell-binding domain of fibronectin are only sufficient for attachment and spreading in normal primary fibroblasts (17), and the integrin alpha 5beta 1, which is the primary ligand for adhesion to fibronectin in this system (1, 3, 5), remains in a diffusely punctuate distribution in the cell membrane (18, 19). An additional stimulus (17-19) is needed for cytoskeletal and membrane reorganization to form stress fibers and focal adhesions (reviewed in Ref. 3), which appear to be not only structural complexes but also to have signaling functions. This can be provided by further stimulation with the near C-terminal heparin-binding domain of fibronectin (Hep II) (17), a synthetic peptide from this domain (18), or by pharmacological activation of protein kinase C (PKC)1 with phorbol esters (19). This causes a redistribution of alpha 5beta 1 into large clusters in focal adhesions and a concomitant redistribution of the cytoplasmic components vinculin and talin (18, 19). Circumstantial evidence has indicated that a cell-surface heparan sulfate proteoglycan may transduce the signal from the Hep II domain of fibronectin (reviewed in Ref. 20). Syndecan-4 is one member of the syndecan family of transmembrane heparan sulfate proteoglycans (20, 21) that is selectively concentrated in the focal adhesions of a range of cells (22) in a PKC-dependent manner (23) and may, therefore, function as a coreceptor with integrins.

The four mammalian syndecans all have highly homologous transmembrane and cytoplasmic domains, except for a short variable (V) region in the center of the cytoplasmic domain (20, 21). The extracellular domains, however, bear little homology. All syndecans form homologous dimers or multimers that resist treatment with SDS (20-22, 24, 25). Asundi and Carey (25) have shown that syndecan-3 core protein assembles into stable, noncovalent multimers mediated by the transmembrane domain and ectodomain flanking region and that this is independent of cysteine residues. Multimerization of syndecan-4 has been seen in biochemical studies (22, 24-27), and the high concentration of this molecule in focal adhesions (22) should favor this. Recently, we showed that syndecan-4 could directly activate PKCalpha in the absence of phospholipid (PL) and potentiate PL-induced activity (26). This ability appears to reside in the central portion of the cytoplasmic domain, which is unique to syndecan-4, based on studies with fusion proteins containing or lacking this region, and with synthetic peptides encompassing this amino acid sequence (26). The recombinant proteins capable of activating PKCalpha were oligomeric, consistent with in vivo data. Preliminary data also suggested that the variable region of syndecan-4 (4V) could also oligomerize. We now report that the degree of oligomerization correlates with the ability to regulate PKCalpha activity, indicating that clustering of syndecan-4 with ligand may control signaling events.


EXPERIMENTAL PROCEDURES

Materials

Synthetic peptides with sequences corresponding to regions of the cytoplasmic domain of syndecan-4 or syndecan-2 (see Table I) were synthesized and sequenced by the University of Alabama at Birmingham (UAB) Comprehensive Cancer Center Peptide Synthesis and Analysis Shared Facility and analyzed by the UAB Comprehensive Cancer Center Mass Spectrometry Shared Facility. Some peptides (e.g. Cys4V) had an additional cysteine at the N terminus. PKCalpha beta gamma purified from rabbit brain was purchased from Upstate Biotechnologies (Lake Placid, NY), recombinant PKCalpha from Molecular Probes (Eugene, OR), [gamma -32P]ATP from DuPont NEN, Sepharose CL-4B and glutathione-agarose beads from Pharmacia Biotech Inc., and protein standards for size exclusion chromatography from Bio-Rad. Phosphatidylserine and diolein were purchased from Avanti Polar Lipids (Alabaster, AL). A peptide encompassing the PKC phosphorylation site in the epidermal growth factor receptor and P-81 phosphocellulose paper were obtained from Biomol Research (Plymouth Meeting, PA) and Whatman, respectively. Antibodies against glutathione S-transferase (GST) were purchased from Molecular Probes, and reduced glutathione was from Janssen Chimica (New Brunswick, NJ). Sephadex G-50 (Fine), Sephadex G-150 (Fine), N-lauroylsarcosine, isopropyl beta -D-thiogalactopyranose, PIP2, inositol hexaphosphate, and other chemicals were all purchased from Sigma.

Table I. The amino acid sequences and molecular mass of peptides derived from cytoplasmic domain of syndecan-4 and syndecan-2

Molecular mass was estimated from the deduced amino acid sequence, by Sephadex G-50 gel filtration chromatography at two different concentrations of calcium, or by 20% SDS-PAGE. N.D., not determined. Molecular mass was estimated from the deduced amino acid sequence, by Sephadex G-50 gel filtration chromatography at two different concentrations of calcium, or by 20% SDS-PAGE. N.D., not determined.
Peptide Sequence Estimation Gel filtration
SDS-PAGE
0 µM Ca2+ 750 µM Ca2+

Da kDa
4L RMKKKDEGSYDLGKKPIYKKAPTNEFYA 3291 6.9 6.6 5.1
Cys4L CRMKKKDEGSYDLGKKPIYKKAPTNEFYA 3394 7.4 6.5 5.3
4V LGKKPIYKK 1060 4.6 4.7 2.9
Cys4V CLGKKPIYKK 1163 8.7 8.7 3.2
Cys2L CRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA 3854 3.8 N.D. 4.2
Cys2V CGERKPSSAAYQK 1466 1.8 N.D. <3.0

Expression and Purification of Recombinant GST-Syndecan-4 Core Protein

A cDNA encoding the entire syndecan-4 core protein or lacking the entire cytoplasmic domain was subcloned into GST expression vector pGEX-5X-1 (Pharmacia) and fusion protein in Escherichia coli induced with 0.1 mM isopropyl beta -D-thiogalactopyranose (26). Bacteria were pelleted by centrifugation for 2 min at 10,000 × g. The pellets were resuspended with TBSE (Tris-buffered saline with EDTA; 10 mM Tris, pH 7.5, 150 mM NaCl, 2 mM EDTA) containing 1 mM dithiothreitol, 0.5 mM phenylmethylsulfonyl fluoride, 1 mM benzamidine HCl, sonicated on ice for 1 min, and N-lauroylsarcosine was added to a final concentration of 1% in TBSE to solubilize recombinant proteins. After 30 min of incubation on ice, insoluble materials were removed by centrifugation at 10,000 × g for 10 min. Supernatants were diluted 10 times with TBSE containing 4% Triton X-100 and applied to 0.5-ml pre-equilibrated glutathione-agarose columns. After washing with TBSE containing 4% Triton X-100 to remove unbound materials, the column was washed once with TBSE containing 1% Triton X-100 and once with TBSE containing 0.1% Triton X-100 to decrease the detergent concentration. Fusion proteins were eluted with 50 mM Tris-HCl, pH 8.0, containing 5 mM reduced glutathione.

Size Exclusion Chromatography

Purified GST-syndecan-4 fusion proteins were loaded onto Sepharose CL-4B or Sephadex G-150 (0.7 × 100 cm) gel filtration columns pre-equilibrated with 50 mM HEPES (pH 7.3), 0.1% CHAPS, and 150 mM NaCl. Proteins were eluted with the same buffer at a flow rate of 6 ml/h at room temperature and detected by measuring the absorbance at 280 nm. The column was calibrated using the protein standards thyroglobulin (670 kDa), bovine gamma -globulin (158 kDa), chicken ovalbumin (44 kDa), equine myoglobin (17 kDa), and vitamin B12 (1.3 kDa). Syndecan-4 peptides were loaded onto Sephadex G-50 gel filtration columns (1.5 × 100 cm, or 0.7 × 100 cm for Fig. 7), and the columns were calibrated with standards comprising carbonic anhydrase (29.0 kDa), equine myoglobin (17.0 kDa), lysozyme (14.3 kDa), aprotinine (6.5 kDa), and vitamin B12 (1.3 kDa).


Fig. 7. The amino acid sequence KPIYK is needed for oligomerization of 4V. Sephadex G-50 gel filtration chromatography of the substituted peptides with N-terminal cysteine are shown: Cys4V (CLGKKPIYKK, bullet ), CysPA (CLGKKAIYKK, open circle ), CysIS (CLGKKPSYKK, triangle ), and CysYF CLGKKPIFKK, square ). The approximate elution positions for peptides of various oligomerization states are shown based on the elution of protein standards.
[View Larger Version of this Image (24K GIF file)]

PKC Assays

Experiments were conducted using either recombinant PKCalpha or PKCalpha beta gamma purified from rabbit brain, with similar results in each case. PKCalpha or PKCalpha beta gamma was incubated in 50 mM HEPES (pH 7.3) at room temperature for 10 min with or without PL, phosphatidylserine, and diolein and with the different syndecan peptides. These assays monitored the effect of peptides to potentiate PL-induced activation of PKCalpha or to directly activate the enzyme in the absence of PL. The reaction mixture (20 µl) contained 3 mM magnesium acetate, 750 µM CaCl2, 200 µM ATP (0.5 µCi of [32P]ATP), 4 µg of histone III-S, 8 ng of PKCalpha , 1 µg of peptide, with or without 4 µg of phosphatidylserine and 0.4 µg of diolein. SDS mixture (5×, direct activation) or trichloroacetic acid (final concentration 20%) with 0.1% SDS (potentiation) was added to stop the reaction. Phosphorylation was quantitated on a PhosphorImager (Molecular Dynamics) after electrophoresis on 20% SDS-PAGE. In assays using 0.1 mg/ml of the epidermal growth factor receptor peptide of the sequence RKRTLRRL (Biomol Research) as an alternative substrate (see Fig. 6), the reaction mixture contained PIP2 (50 µM) and/or syndecan-4 peptide (4L; 0.25 mg/ml) in the absence of PL and calcium, and PKCalpha beta gamma mixture (3 ng) was used. The reaction was stopped by spotting the whole reaction mixture onto phosphocellulose filters (Whatman, P-81, 2.1 cm) and dropping these into 75 mM phosphoric acid. The phosphocellulose filters were washed three times for 10 min each, immersed in 95% ethanol for 5 min, dried, and counted with 4 ml of scintillation mixture in a scintillation counter (Wallac model 1409).


Fig. 6. PIP2 induces a higher oligomeric status of 4L peptide consistent with PKC potentiation activity. A, Sephadex G-50 gel filtration chromatography of 4L peptide in the absence of phospholipid (black-triangle) and in the presence of PIP2 (open circle ) or inositol hexaphosphate (square ) are shown. B, oligomeric forms of 4L promoted by PIP2 potentiate PKCalpha beta gamma (lane 4) phosphorylation of epidermal growth factor receptor peptide. Relative activity is indicated by mean ± S.E. (n = 4) compared with that in the absence of peptide and effector (lane 1).
[View Larger Version of this Image (17K GIF file)]


RESULTS

Multimerization of Syndecan-4 Core Protein Correlates with PKC Regulatory Activity

Our previous studies showed that recombinant syndecan-4, in which the core protein formed SDS-resistant oligomers, could increase the ability of PKCalpha to phosphorylate histone III-S (26). Therefore, we investigated whether this multimeric form is critical for its potentiation activity. Gel chromatography of pure preparations of recombinant syndecan-4 on Sepharose CL-4B under nondenaturing conditions showed that the major species had a Mr ~500,000 (Fig. 1A), indicating that the major form of intact syndecan-4 is oligomeric. We could sometimes also detect minor pools of Mr ~350,000 and ~230,000 (data not shown). These oligomeric core proteins migrated on SDS-PAGE gels as a single population with apparent Mr ~150,000 (Fig. 1B). Since the deduced molecular mass of the fusion protein is 49 kDa, fusion protein resolves on denaturing gels as oligomers, possibly dimers. Reduction had no effect; the core protein of syndecan-4 in any case contained no cysteine. However, a single freeze-thaw cycle dissociated this oligomeric form into monomeric proteins migrating with Mr ~53,000 on Sephadex G-150 gel chromatography (Fig. 1A) and ~50,000 on SDS-PAGE gels (Fig. 1B). Although multimeric forms of intact syndecan-4 core protein could potentiate PKCalpha activity to phosphorylate histone III-S (Fig. 1C; compare lanes 1 and 2), monomeric forms of syndecan-4 core protein did not have this activity (Fig. 1C, compare lanes 1 and 3). Similar potentiation was seen with both purified PKCalpha beta gamma mixture and recombinant PKCalpha (data not shown).


Fig. 1. Potentiation of PKCalpha activity by multimeric, but not monomeric, syndecan-4 core protein. A, native Mr of multimeric (bullet ) and monomeric (open circle ) recombinant GST-syndecan-4 proteins were analyzed by Sepharose CL-4B or Sephadex G-150. Arrows show the molecular mass of thyroglobulin (670 kDa), bovine gamma -globulin (158 kDa), chicken ovalbumin (44 kDa), and equine myoglobin (17 kDa). B, Coomassie Blue (lanes 1 and 2) and anti-GST immunoblots (lanes 3 and 4) show multimeric (lanes 1 and 3) and monomeric (lanes 2 and 4) proteins. C, multimeric, but not monomeric, syndecan-4 potentiated PL-mediated phosphorylation of histones by PKCalpha . Relative activity is indicated by mean ± S.E. (n = 4) compared with that in the presence of recombinant syndecan-4 in which the entire cytoplasmic domain has been deleted (Control).
[View Larger Version of this Image (34K GIF file)]

PKCalpha beta gamma Regulation Requires Multimerization of Syndecan-4 Cytoplasmic Domains

As reported previously, mutants of syndecan-4 with partially or totally truncated cytoplasmic domains could not increase PKCalpha activity, although they did form oligomers (26). A peptide from this domain was also active (26). Since oligomerization of the core protein was needed for PKC regulatory activity, we monitored whether synthetic peptides with sequences from the cytoplasmic domain could oligomerize and if this correlated with the ability to regulate PKC activity. The apparent molecular masses of syndecan-4 peptides encompassing the whole cytoplasmic domain (4L) or just the variable region unique to syndecan-4 (4V) as estimated by Sephadex G-50 gel chromatography are larger than predicted (Table I). Peptide 4L eluted close to putative dimeric size, whereas 4V eluted as a tetramer. Therefore, with respect to syndecan-4, two sites in the core protein are involved in oligomerization: the transmembrane and/or ectodomains as shown for syndecan-3 (25), and the central region of its cytoplasmic domain. However, the highly basic region of syndecan-4 proximal to the membrane from the V region appears to limit self-association of 4L compared with 4V in the absence of phospholipid (see below). In agreement with a need for oligomerization for PKCalpha beta gamma regulatory activity, 4V but not 4L could potentiate PL-induced activation of PKCalpha beta gamma to phosphorylate histones (Fig. 2A) and directly activate PKCalpha beta gamma in the absence of PL (Fig. 2B). Equivalent syndecan-2 peptides, which lack PKC regulatory activity (26), were also examined, since syndecan-2 is the closest homologue to syndecan-4 but lacks the required cytoplasmic sequence for PKC regulation (20, 21, 26). Both gel chromatography and SDS-PAGE indicated a lack of apparent oligomerization of syndecan-2 peptide (Table I), confirming the unique ability of syndecan-4 cytoplasmic domain to self-associate. GST fusion proteins containing the whole syndecan-2 core protein, however, do migrate with similar properties to syndecan-4 on SDS-PAGE gels, confirming the general ability of syndecan core proteins to self-associate (data not shown). Taken together, the results show that although transmembrane regions of syndecans promote SDS-resistant oligomer formation (putative dimers), further oligomerization to form tetramers or higher oligomers, as seen with 4V peptides and whole syndecan-4 fusion proteins, is required for PKCalpha beta gamma (or PKCalpha ) activation.


Fig. 2. Oligomeric syndecan 4V peptides can regulate PKCalpha beta gamma activity. Potentiation of PL-mediated PKCalpha beta gamma activity was seen with peptides 4V and Cys4V (A), and direct activation of PKCalpha beta gamma by 4V was increased by N-terminal cysteine (Cys4V). PKC assays were performed as described under "Experimental Procedures" in the presence (A) or absence (B) of PL. Phosphorylated histone was separated by 20% SDS-PAGE and analyzed by PhosphorImager (Molecular Dynamics). Relative activity is indicated by mean ± S.E. (n = 3) compared with that in the absence of peptide (CON).
[View Larger Version of this Image (15K GIF file)]

We tested whether the addition of cysteine to the N terminus of 4V and 4L peptides could induce higher order clustering and concomitantly increase PKCalpha beta gamma or PKCalpha regulatory activity. Cys4V eluted at 8.7 kDa (Table I), indicative of an octamer, even though electrospray ionization mass spectrometry showed the molecular mass as 1.1 kDa (data not shown).2 Thus, the N-terminal cysteine on Cys4V may aid V region multimerization. This had no statistically significant effect on the ability of 4V to potentiate PL-induced PKCalpha beta gamma activity (Fig. 2A), but direct activation of PKCalpha beta gamma by Cys4V (i.e. in the absence of PL) was greater than that seen with 4V (Fig. 2B). In the presence of PL, both 4V and Cys4V could potentiate the normally maximal activity by 4-fold. In the absence of PL, when PKCalpha beta gamma is normally inactive, 4V and Cys4V caused 1.7- and 3.0-fold direct activation. In contrast, Cys4L, having cysteine at the N terminus of 4L, still eluted at 7.4 kDa as a dimer (Table I) and was no more active in regulating PKCalpha beta gamma activity than 4L (Fig. 2). Calcium concentrations can affect protein-protein interactions, and phosphorylation experiments were performed in 750 µM calcium to maximize PKCalpha beta gamma activity (28). However, gel filtration at this calcium concentration did not affect the multimeric status of the peptides (Table I). These multimeric peptides were resistant to SDS, although the apparent Mr on SDS-PAGE was lower than that seen by gel filtration, being only 1.5- to 3-fold that deduced from the amino acid sequence (Table I). For example, both 4V and Cys4V migrated with an apparent Mr ~3000. Both methods of estimation depend on the secondary structure of the molecules tested, with gel filtration being less denaturing. Further control experiments with 2V and 2L peptides showed that N-terminal cysteine residues did not induce their oligomerization (Table I).

The results so far indicate that 1) syndecan-4 core protein multimerization correlates with PKC potentiation; 2) the V region of the cytoplasmic domain of syndecan-4 can itself form homopolymers as does recombinant core protein; 3) multimerization is independent of calcium concentration; 4) dimerization is not sufficient for PKCalpha beta gamma regulatory activity since 4L is inactive; and 5) tetrameric 4V is sufficient for potentiation of PL-induced PKCalpha beta gamma activity, but direct activation of PKCalpha beta gamma is more effective with octameric forms seen with Cys4V.

Reduction of Cys4V Oligomerization Results in Decreased Regulation of PKC Activity

When incubated with PKCalpha beta gamma and [32P]ATP in the absence of PL, Cys4V, but not 4V, was itself phosphorylated even though it lacks serine or threonine amino acids (Table I, Fig. 3A). Although the phosphorylation of peptide Cys4V was 10-fold less than that of histone III-S, it was time-dependent (Fig. 3A). Since 4V was not phosphorylated, Cys4V phosphorylation may be on cysteine thiol groups (29). To investigate whether this phosphorylation affected the direct activation of PKCalpha beta gamma by Cys4V, peptides Cys4V, 4V, or 4L were "cold-phosphorylated" by preincubation with PKCalpha beta gamma and ATP in the absence of PL (Fig. 3B, lanes 4-6). Their capacities to subsequently activate PKCalpha beta gamma were compared with those of peptides similarly incubated with PKCalpha beta gamma but without ATP (Fig. 3B, lanes 1-3). Minimal histone phosphorylation by PKCalpha beta gamma was seen in the presence of 4L (lane 1), and this was slightly reduced following incubation with cold ATP and PKCalpha beta gamma (lane 4). Peptide 4V promoted histone phosphorylation to a similar extent with (lane 5) or without (lane 2) pretreatment. In contrast, the ability of Cys4V to promote histone phosphorylation (lane 3) was markedly reduced (lane 6) by preincubation with ATP and PKCalpha beta gamma . Thus, preincubation of Cys4V with cold ATP and PKCalpha beta gamma caused a loss of ability to activate PKCalpha beta gamma . To determine whether phosphorylation of Cys4V altered its oligomeric structure, we incubated Cys4V with PKCalpha beta gamma  ± 200 µM cold ATP for 10 min at 37 °C and analyzed the peptide by Sephadex G-50 gel filtration chromatography (Fig. 4). Cys4V and 4V maintained their original elution profiles (8.7 and 4.6 kDa, respectively) in the absence of enzyme, but elution of phosphorylated Cys4V was markedly altered, with a minor population eluting at 8.7 kDa as before, but most at 3.9 kDa. Thus, phosphorylation appeared to cause a reduction in the multimeric nature of Cys4V, paralleling a loss in its ability to directly activate PKCalpha beta gamma . A further control experiment was performed to analyze whether cysteine thiol group phosphorylation itself was inhibitory independent of peptide multimerization. To do this, peptides based on syndecan 4V sequence (CLGKPIYK or CLGKKPIKK, where two lysine residues were substituted with arginine or the tyrosine residue was substituted with phenylalanine) were used. These were inactive in regulating PKC activity (26) but could be readily phosphorylated. These peptides, when phosphorylated as described above, had no effect on the subsequent ability of "wild type" Cys4V to activate PKCalpha beta gamma (data not shown). Therefore, reducing the oligomerization status of Cys4V peptide was directly related to decreased PKCalpha beta gamma regulation.


Fig. 3. Preincubation in the presence of PKCalpha beta gamma and cold ATP reduces the direct activation of PKCalpha beta gamma by Cys4V peptide. A, time course for direct activation of PKCalpha beta gamma by Cys4V. B, preincubation with PKCalpha beta gamma and peptides as shown contained 200 µM cold ATP in lanes 4-6 but not in lanes 1-3. After 10 min of preincubation, a mixture of 200 µM cold ATP and 0.5 µCi of [32P]ATP (lanes 1-3) or 0.5 µCi of [32P]ATP alone (lanes 4-6) was added together with histone III-S. Autoradiography of phosphorylated histone (HIS) on 20% SDS-PAGE is shown. The positions of migration of molecular mass markers (kDa), phosphorylated Cys4V, and histone (HIS) are indicated.
[View Larger Version of this Image (43K GIF file)]


Fig. 4. Preincubation in the presence of PKCalpha beta gamma and cold ATP reduces the apparent mass of Cys4V. The molecular mass of 4V or Cys4V was analyzed by Sephadex G-50 gel filtration column chromatography before (square , 4V; open circle , Cys4V) or after (black-square, 4V; bullet , Cys4V) preincubation in the presence of PKCalpha beta gamma and cold ATP.
[View Larger Version of this Image (24K GIF file)]

Aggregation of Syndecan-4 Cytoplasmic Domain by PIP2 Results in PKCalpha beta gamma Regulatory Activity

As shown before, the sequence KPIYK is critical in the up-regulation of PKC activity (26). This sequence is present in both syndecan 4V and 4L, but 4L activated PKCalpha beta gamma much less than 4V. Although this appears to parallel multimerization status, it was also possible that the highly basic membrane-proximal region of syndecan-4 cytoplasmic domain (Table I) could directly inhibit the effects of 4V. This was ruled out by addition of five times excess of 4L or of 2L, the latter having no ability to regulate PKCalpha beta gamma but possessing a highly homologous membrane-proximal sequence. These had no effect on potentiation of PL-induced PKCalpha beta gamma activity by 4V (Fig. 5A) or on direct activation of PKCalpha beta gamma by Cys4V (Fig. 5B). It was, therefore, most likely that it was the lack of multimerization of 4L, rather than the presence of membrane-proximal highly basic amino acids, that resulted in its reduced activity. This was confirmed by increasing the oligomerization of 4L by the addition of PIP2. After preincubating 4L peptide with PIP2 (1:1 molar ratio), 4L molecular weight was analyzed by Sephadex G-50 gel filtration. Approximately 30% of the 4L peptide eluted with higher apparent molecular weight (Mr ~35,000), which is approximately eight times greater than the deduced molecular weight of 4L (3300) and PIP2 (1100) combined (Fig. 6A). No phosphorylation was seen in the absence of PIP2 and 4L (Fig. 6B, lane 1). Peptide 4L alone had no effect (lane 2), whereas PIP2 partially activated PKCalpha beta gamma (lane 3) as previously shown (30, 31). The PIP2-syndecan 4L complex resulted in a marked potentiation of PKCalpha beta gamma phosphorylation of epidermal growth factor receptor peptide (Fig. 6B, lane 4) and histone III-S (data not shown). The specificity of this interaction between 4L and PIP2 with respect to oligomerization and PKCalpha beta gamma regulation was demonstrated in several assays. First, the addition of PIP2 to syndecan-2 cytoplasmic peptides was without effect on PKCalpha beta gamma activity. Second, inositol hexaphosphate was unable to affect 4L oligomerization (Fig. 6A) or PKCalpha beta gamma activity (Fig. 6B), even though, like PIP2, inositol hexaphosphate can interact with the 4L peptide.3 Third, both phosphatidylinositol 3,4,5-triphosphate and inositol 1,3,4,5-tetraphosphate were also unable to replicate the oligomerization or PKCalpha beta gamma regulatory activity (data not shown).


Fig. 5. Neither 4L nor 2L affect the ability of 4V to potentiate PL-mediated activation of PKCalpha beta gamma (A) or to directly activate PKCalpha beta gamma (B). PKC assays were performed as described under "Experimental Procedures" in the presence (A) or absence (B) of PL and with increasing concentrations of 4L or 2L as shown above each autoradiograph of phosphorylated histone on 20% SDS-PAGE. 50 µg/ml 4V were used for potentiation (A), and 50 µg/ml Cys4V were used for direct activation (B).
[View Larger Version of this Image (61K GIF file)]

The Amino Acid Sequence KPIYK Is Needed for Multimerization

We have shown that the amino acid sequence KPIYK is critical for both direct activation of PKCalpha beta gamma and for potentiation of PL-induced activation (26), since peptides of altered sequence showed reduced activity. Therefore, we investigated whether this was due solely to the specific amino acid sequence or whether activity paralleled the amount of multimerization of the altered peptides. As shown in Fig. 7, although Cys4V eluted as a putative octamer on Sephadex G-50 gel filtration, all the other peptides (sequences shown in the legend to Fig. 7) eluted with a more broad profile, indicative of a range of oligomerization states. Although some substituted peptides had a little potentially octameric content, most eluted with smaller mass. CysIS, in which the isoleucine was replaced by serine, eluted mainly as a tetramer, with some monomer. CysPA, with proline replaced by alanine, eluted as a mixture of tetra-, di-, and monomer, with 30% being monomeric. CysKR, in which two lysine residues were replaced by arginine, was insoluble at the high concentration needed for these experiments. CysYF, with tyrosine replaced by phenylalanine, eluted as three peaks, the largest material being of similar size to that of Cys4V (octameric). In parallel with this, CysIS and CysPA showed very limited ability in our previous studies (data not shown, but see Ref. 26) to directly activate PKCalpha beta gamma to phosphorylate histones or to potentiate PL-induced activation. In contrast, CysYF showed more, although somewhat variable, activity, but it was never as active as Cys4V or 4V. Since 4V is more active than those peptides that also form tetramers (CysIS and CysPA) and even CysYF, which forms some octamers, both multimerization state and specific amino acid sequence seem to regulate PKCalpha beta gamma activity.


DISCUSSION

It is a common characteristic of syndecans that their core proteins form homologous dimers or multimers. Isolated core proteins migrate on SDS-PAGE with apparent molecular masses significantly higher than those deduced from cDNA sequence analysis (21, 27). This occurs even with fusion proteins isolated from bacteria in which glycosylation can have no effect (24-26) and with fusion proteins lacking the cytoplasmic domain (25, 26). We confirm here that GST fusion proteins containing the core protein of syndecan-4 formed stable oligomers when analyzed by both gel chromatography and SDS-PAGE. Gel chromatography indicated that syndecan-4 core protein can form higher order oligomers (tetramers and perhaps octamers) under nondenaturing conditions. These forms of syndecan-4 had potent PKC up-regulatory activity (Ref. 26 and this study). Oligomerization did not involve cystine formation, since syndecan-4 lacks cysteine residues, and oligomers could be dissociated by a single freeze-thaw cycle, demonstrating that the interactions were noncovalent. Dissociation into monomeric forms correlated with the loss of ability of syndecan-4 fusion proteins to regulate PL-induced PKC activity. This supports previous data (25) that the cytoplasmic domain of syndecans is not necessary for self-association. These fusion proteins still contained the full ectodomain of syndecan-4, but the lysine critical for self-association of syndecan-3 is not present in syndecan-4 (21, 25, 31-33), suggesting that other interaction sites must exist in the ectodomain of syndecan-4. It is improbable that the GST portion of the syndecan-4 fusion protein was responsible for SDS-resistant self-association, since this is not a common occurrence in this type of fusion protein and other studies indicate that oligomerization is a common property of syndecans (21-27).

A major finding here was that, in addition to sites in the transmembrane and/or ectodomain promoting oligomerization, the V region of syndecan-4 cytoplasmic domain, but not of syndecan-2, could itself oligomerize. Peptides corresponding to this region migrated on SDS-PAGE gels with increased apparent Mr, but the full extent of oligomerization was revealed by gel filtration, where oligomeric status up to putative octamers was seen, particularly when oligomerization was enhanced by addition of N-terminal cysteine. Direct correlations between oligomerization and PKCalpha beta gamma regulatory ability were noted. Peptide Cys4V, which formed putative octamers by gel filtration, was more active than 4V, which formed tetramers. Peptide 4V in turn was more active than 4L, which, in the absence of PIP2, formed only dimers. In addition, when multimerization of Cys4V was reduced by phosphorylation, its ability to regulate PKCalpha beta gamma activity decreased. Peptides encompassing the whole cytoplasmic domain showed less tendency to oligomerize than those containing just the V region, probably due to the high charge of the C1 region normally proximal to the membrane. However, the reduced tendency of the 4L peptide to oligomerize was partly overcome by PIP2 in vitro, since PIP2 induced higher oligomeric structures. This also increased the ability of the 4L peptide to potentiate PKC activity. We believe that the interaction of PIP2 with syndecan-4 may be of biological significance, and this is under investigation in our laboratory. Of particular relevance may be that PIP2 could partially activate PKC, and this was further enhanced by 4V or 4L peptides. Thus, as seen previously in vivo during cell adhesion, accumulated PIP2 resulting from PIP kinase activity induced on integrin-mediated adhesion (reviewed in Refs. 3 and 6) may increase or stabilize the oligomerization status of syndecan-4 cytoplasmic domain and induce the potentiation of PKC activity. Regulation of other focal adhesion components, such as vinculin and alpha -actinin, by PIP2 has also been shown (3, 34-36), and we hypothesize that PIP2 may regulate syndecan-4 and PKCalpha , two additional focal adhesion components.

Biological activity of the syndecan-4 cytoplasmic domain is not due solely to oligomeric status, since peptides of altered sequence, even when tetrameric or partially octameric (e.g. CLGKKPIKK, where a single tyrosine was replaced by a phenylalanine residue), were much less active than the corresponding oligomeric forms of the native peptides. Preliminary data4 using circular dichroism spectroscopy also indicate that although the 4V peptide has secondary structure, this is partially or totally lost when residue substitutions are made or the peptide sequence is scrambled. Further long term studies with nuclear magnetic resonance spectroscopy are underway to examine peptide-peptide and peptide-PIP2 interactions.

Dimerization or oligomerization of membrane receptors often activate signaling cascades with phosphorylated tyrosines binding SH2 domain-containing adapter proteins (3-6). Receptors with intrinsic tyrosine kinase activity undergo transphosphorylation, whereas cytokine receptors, which lack intrinsic kinase activity, can recruit and/or activate kinases following oligomerization in response to ligand binding (37). Indeed, integrin beta 1 can have associated kinases (15, 16). PKC activation is required for cell adhesion (38-40), migration (41), and particularly for focal adhesion formation (19), and PKCalpha is concentrated at the focal adhesions of normal but not transformed cells (42), where syndecan-4 is also highly concentrated (22). Syndecan-4, but not syndecan-2, V region can bind PKC and either directly activate it or potentiate conventional PL-induced activation (26), but, as shown here, it can do so only when in oligomeric form. Our working model is that syndecan-4, like other syndecans, is expressed on the cell surface in dimeric form. Upon ligand binding, e.g. fibronectin's heparin-binding (Hep II) domain (17, 18), further oligomerization takes place. Indeed, focal adhesions have the appearance of cell surface "patches" with clustering of transmembrane and actin-associated cytoskeletal components (12). This oligomerization, perhaps facilitated by PIP2 binding, the presence of which is increased on adhesion (11), then localizes PKCalpha and activates the kinase in nascent adhesions. What remains to be established is whether PKC interactions in the presence of PIP2 require it to be preactivated or whether the involvement of PIP2 is sufficient to form a ternary complex. The requirement of PIP2 for focal adhesion formation, however, is clear (35).

Syndecan-4 shares some characteristics with other enzyme-binding proteins but also has some differences. It is similar to proteins that interact with C kinase and receptors for activated C kinase in that it may localize specific enzymes to cellular target areas (43, 44). However, it appears to bind the catalytic domain of PKC and can enhance the activity of the isolated catalytic domain, PKM (26). In addition, PKC-syndecan-4 interactions are dependent on enzyme activation (26). One major difference from previously reported enzyme-binding proteins is that syndecan-4 is a transmembrane proteoglycan involved as a coreceptor with integrins in cell adhesion, the multimerization status of which, and therefore the biological activity of which, may be directly determined by interactions with extracellular ligands.


FOOTNOTES

*   This work was supported by National Institutes of Health Grant GM50194.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Dagger    To whom correspondence should be addressed: Dept. of Cell Biology, Cell Adhesion and Matrix Research Center, Volker Hall 201C, University of Alabama at Birmingham, Birmingham, AL 35294-0019. Tel.: 205-934-2626; Fax: 205-975-9956; E-mail: jrcouchman{at}cellbio.bhs.uab.edu.
1   The abbreviation used are: PKC, protein kinase C; GST, glutathione S-transferase; PL, phospholipid; PIP2, phosphatidylinositol 4,5-bisphosphate; HEPES, 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid; CHAPS, 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate; PAGE, polyacrylamide gel electrophoresis.
2   The mass spectrometer was purchased (National Institutes of Health Grant S10RR06487) and operated by the Comprehensive Cancer Center Mass Spectrometry Shared Facility, University of Alabama at Birmingham (supported in part by National Cancer Institute Grant P30CA13148).
3   J. R. Couchman, A. Woods, E.-S. Oh, A. Theibert, and G. Prestwich, unpublished data.
4   E.-S. Oh, A. Woods, and J. R. Couchman, unpublished data.

ACKNOWLEDGEMENTS

We thank Dr. J. T. Gallagher and his colleagues (University of Manchester, United Kingdom) for the provision of cDNAs encoding syndecan-4 core proteins. We also thank Marion Kirk at the UAB Comprehensive Cancer Center Mass Spectrometry Shared Facility for the mass spectrometry analysis of peptides.


REFERENCES

  1. Hynes, R. O. (1992) Cell 69, 11-25 [CrossRef][Medline] [Order article via Infotrieve]
  2. Ruoslahti, E. (1996) Annu. Rev. Cell Dev. Biol. 12, 697-715 [CrossRef][Medline] [Order article via Infotrieve]
  3. Burridge, K., and Chrzanowska-Wodnicka, M. (1996) Annu. Rev. Cell Biol. 12, 463-579 [CrossRef][Medline] [Order article via Infotrieve]
  4. Dedhar, S., and Hannigan, G. E. (1996) Curr. Opin. Cell Biol. 8, 657-669 [CrossRef][Medline] [Order article via Infotrieve]
  5. Humphries, M. J. (1996) Curr. Opin. Cell Biol. 8, 632-640 [CrossRef][Medline] [Order article via Infotrieve]
  6. Schwartz, M. A., Schaller, M. D., and Ginsberg, M. H. (1995) Annu. Rev. Cell Dev. Biol. 11, 549-599 [CrossRef][Medline] [Order article via Infotrieve]
  7. Guan, J. L., Trevithick, J. E., and Hynes, R. O. (1991) Cell Regul. 2, 951-964 [Medline] [Order article via Infotrieve]
  8. Kornberg, L. J., Earp, H. S., Turner, C. E., Prockop, C., and Juliano, R. L. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 8392-8396 [Abstract/Free Full Text]
  9. Ng-Sikorski, J., Andersson, R., Patarroyo, M., and Andersson, T. (1991) Exp. Cell Res. 195, 504-508 [CrossRef][Medline] [Order article via Infotrieve]
  10. Schwartz, M. A., and Lechene, C. (1992) Proc. Natl. Acad. U. S. A. 89, 6138-6141 [Abstract/Free Full Text]
  11. McNamee, H. M., Ingber, D. E., and Schwartz, M. A. (1992) J. Cell Biol. 121, 673-678 [Abstract/Free Full Text]
  12. Miyamoto, S., Teramato, H., Coso, O. A., Gutkind, J. S., Burbelo, P. D., Akiyama, S. K., and Yamada, K. M. (1995) J. Cell Biol. 131, 791-805 [Abstract/Free Full Text]
  13. van der Geer, P., Hunter, T., and Lindberg, R. A. (1994) Annu. Rev. Cell Dev. Biol. 10, 251-337 [CrossRef]
  14. Lemmon, M. A., and Schlessinger, J. (1994) Trends Biol. Sci. 19, 459-463
  15. Hannigan, G. E., Leung-Hagesteijn, C., Fitz-Gibbon, L., Coppolino, M. G., Radeva, G., Filmus, J., Bell, J. C., and Dedhar, S. (1996) Nature 379, 91-96 [CrossRef][Medline] [Order article via Infotrieve]
  16. Schaller, M. D., Otey, C. A., Hildebrand, J. D., and Parsons, J. T. (1996) J. Cell Biol. 130, 1181-1187 [Abstract/Free Full Text]
  17. Woods, A., Couchman, J. R., Johansson, S., and Hook, M. (1986) EMBO J. 5, 665-670 [Medline] [Order article via Infotrieve]
  18. Woods, A., McCarthy, J. B., Furcht, L. T., and Couchman, J. R. (1993) Mol. Biol. Cell 4, 605-613 [Abstract]
  19. Woods, A., and Couchman, J. R. (1992) J. Cell Sci. 101, 277-290 [Abstract/Free Full Text]
  20. Couchman, J. R., and Woods, A. (1990) J. Cell. Biochem. 61, 578-584
  21. Bernfield, M., Kokenyesi, R., Kato, M., Hinkes, M. T., Spring, J., Gallo, R. L., and Lose, E. J. (1992) Annu. Rev. Cell Biol. 8, 365-393 [CrossRef]
  22. Woods, A., and Couchman, J. R. (1994) Mol. Biol. Cell 5, 183-192 [Abstract]
  23. Baciu, P., and Goetinck, P. F. (1995) Mol. Biol. Cell 6, 1503-1513 [Abstract]
  24. Pierce, A., Lyon, M., Hampson, I. N., Cowling, G. J., and Gallagher, J. T. (1992) J. Biol. Chem. 267, 3894-3900 [Abstract/Free Full Text]
  25. Asundi, V. K., and Carey, D. J. (1995) J. Biol. Chem. 270, 26404-26410 [Abstract/Free Full Text]
  26. Oh, E. S., Woods, A., and Couchman, J. R. (1996) J. Biol. Chem. 272, 8133-8136 [Abstract/Free Full Text]
  27. Miettinen, H. M., Edwards, S., and Jalkanen, M. (1994) Mol. Biol. Cell 5, 1325-1339 [Abstract]
  28. Nishizuka, Y. (1986) Science 233, 305-310 [Abstract/Free Full Text]
  29. Guan, K., and Dixon, J. E. (1991) J. Biol. Chem. 266, 17026-17030 [Abstract/Free Full Text]
  30. Chauhan, A., Brockerhoff, H., Winsniewski, H. M., and Chauhan, V. S. P. (1991) Arch. Biochem. Biophys. 287, 283-287 [CrossRef][Medline] [Order article via Infotrieve]
  31. Kojima, T., Shworak, N. W., and Rosenberg, R. D. (1992) J. Biol. Chem. 267, 4870-4877 [Abstract/Free Full Text]
  32. David, G., van der Schueren, B., Marynen, P., Cassiman, J.-J., and van den Berghe, H. (1992) J. Cell Biol. 118, 961-969 [Abstract/Free Full Text]
  33. Baciu, P. C., Acaster, C., and Goetinck, P. F. (1994) J. Biol. Chem. 269, 696-703 [Abstract/Free Full Text]
  34. Fukami, K., Endo, T., Imamura, M., and Takenawa, T. (1994) J. Biol. Chem. 269, 1518-1522 [Abstract/Free Full Text]
  35. Gilmore, A. P., and Burridge, K. (1996) Nature 381, 531-535 [CrossRef][Medline] [Order article via Infotrieve]
  36. Weekes, J., Barrey, S. T., and Critchley, D. R. (1996) Biochem. J. 314, 827-832
  37. Wilks, A. W., and Harpur, A. G. (1994) BioEssays 16, 313-320 [CrossRef][Medline] [Order article via Infotrieve]
  38. Vuori, K., and Ruoslahti, E. (1993) J. Biol. Chem. 268, 21459-21462 [Abstract/Free Full Text]
  39. Chun, J. S., and Jacobson, B. S. (1993) Mol. Biol. Cell 4, 271-281 [Abstract]
  40. Ponta, H., Sleeman, J., and Herrlich, P. (1994) Biochim. Biophys. Acta 1198, 1-10 [Medline] [Order article via Infotrieve]
  41. Leavesley, D. I., Schwartz, M. A., Rosenfeld, M., and Cheresh, D. A. (1993) J. Cell Biol. 121, 163-170 [Abstract/Free Full Text]
  42. Hyatt, S. L., Klauck, T., and Jaken, S. (1990) Mol. Carcinogen. 3, 45-53 [Medline] [Order article via Infotrieve]
  43. Mochly-Rosen, D., Khanel, H., and Lopez, J. (1991) Proc. Natl. Acad. Sci. U. S. A. 88, 3997-4000 [Abstract/Free Full Text]
  44. Staudinger, J., Zhou, J., Burgess, R., Elledge, S. J., and Olson, E. N. (1995) J. Cell Biol. 128, 263-271 [Abstract/Free Full Text]

©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
J. Biol. Chem.Home page
I. H. Lee, H. J. Lim, S. Yoon, J. K. Seong, D. S. Bae, S. G. Rhee, and Y. S. Bae
Ahnak Protein Activates Protein Kinase C (PKC) through Dissociation of the PKC-Protein Phosphatase 2A Complex
J. Biol. Chem., March 7, 2008; 283(10): 6312 - 6320.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
I. C. Dews and K. R. MacKenzie
Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions
PNAS, December 26, 2007; 104(52): 20782 - 20787.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J. R. Whiteford and J. R. Couchman
A Conserved NXIP Motif Is Required for Cell Adhesion Properties of the Syndecan-4 Ectodomain
J. Biol. Chem., October 27, 2006; 281(43): 32156 - 32163.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
K. J. McQuade, D. M. Beauvais, B. J. Burbach, and A. C. Rapraeger
Syndecan-1 regulates {alpha}v{beta}5 integrin activity in B82L fibroblasts
J. Cell Sci., June 15, 2006; 119(12): 2445 - 2456.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
E. Tkachenko, A. Elfenbein, D. Tirziu, and M. Simons
Syndecan-4 Clustering Induces Cell Migration in a PDZ-Dependent Manner
Circ. Res., June 9, 2006; 98(11): 1398 - 1404.
[Abstract] [Full Text] [PDF]


Home page
IOVSHome page