Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Strub, J.-M.
Right arrow Articles by Metz-Boutigue, M.-H.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Strub, J.-M.
Right arrow Articles by Metz-Boutigue, M.-H.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 272, Number 18, Issue of May 2, 1997 pp. 11928-11936
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Phosphorylation and O-Glycosylation Sites of Bovine Chromogranin A from Adrenal Medullary Chromaffin Granules and Their Relationship with Biological Activities*

(Received for publication, December 19, 1996, and in revised form, February 27, 1997)

Jean-Marc Strub Dagger , Odile Sorokine §, Alain Van Dorsselaer §, Dominique Aunis Dagger and Marie-Hélène Metz-Boutigue Dagger

From the Dagger  Institut National de la Santé et de la Recherche Médicale, Unité 338 de Biologie de la Communication Cellulaire, 67084 Strasbourg Cedex, France and § Centre National de la Recherche Scientifique, Laboratoire de Spectrométrie de Masse Bioorganique, URA 31, Chimie Organique des Substances Naturelles, 67084 Strasbourg Cedex, France

ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES


ABSTRACT

Bovine adrenal medullary chromogranin A, the major soluble component of chromaffin granules, is a phosphorylated glycoprotein. In the present work, phosphorylation and glycosylation sites were determined using mild proteolysis, peptide separation, microsequencing, and mass analysis by electrospray and matrix-assisted laser desorption ionization time-of-flight techniques. Seven post-translational modification sites were detected. Two O-linked glycosylation sites, each consisting of the trisaccharide NeuAcalpha 2-3Galbeta 1-3GalNAcalpha 1, were located in the middle part of the protein, on Ser186 and on Thr231. The former residue is present in the antibacterial peptide named chromacin. Four phosphorylation sites were located on serine residues at positions Ser81 in the N-terminal region of the protein and Ser307, Ser372, and Ser376 in the C-terminal end. One additional phosphorylation site was found on the tyrosine residue at position Tyr173, the N-terminal amino acid of chromacin. With the exception of the phosphorylation on Tyr173, all of the other post-translational modifications are located on highly conserved chromogranin A regions, implying some biological importance.


INTRODUCTION

In bovine adrenal medulla, secretory granules from chromaffin cells contain a complex mixture of secretory products, which include low molecular mass constituents such as catecholamines, ascorbate, nucleotides, calcium, enkephalins, and several water-soluble proteins. Among the latter, chromogranins/secretogranins a family of acidic secretory proteins, have been extensively studied. CGA1 is the major member (40% of total soluble granule proteins) of this family, and these glycoproteins are expressed in a large number of endocrine and neuroendocrine cells and in neurons (1-4). At the subcellular level, chromogranins are exclusively found in the soluble core of hormone and neurotransmitter storage vesicles and are released during exocytosis. Chromogranins have been proposed to play multiple roles in the secretory process. An intracellular function as a "helper" protein in the packaging of peptides, hormones, and neuropeptides by virtue of their ability to aggregate in the low pH and high calcium environment of the trans-Golgi network and as modulators of the processing of these components has been suggested (3). Extracellularly, different members of the chromogranin family are now considered as precursor proteins that are actively processed into peptides within the secretory granules (for reviews, see Refs. 1 and 5). Recently, we reported a detailed study of the intracellular and extracellular processing of CGA and chromogranin B in bovine chromaffin granules from intact gland and from cultured chromaffin cells (6, 7).

The proteolytic processing of CGA is a topic of growing interest, since biological activities have been attributed to specific domains located along its sequence. For example, in the N-terminal domain, a peptide corresponding to the sequence 1-113 has been shown to inhibit hormone secretion in the bovine parathyroid gland (8); a homologous peptide, betagranin, corresponding to the sequence 1-115 has been isolated from rat pancreas, but its function has not yet been defined (9). Vasostatins are peptides containing the N-terminal sequence 1-76/113 (10) and have been found to exhibit vasoinhibitory activity of isolated human blood vessels (11, 12). As early as 1988, it was established that CGA is the precursor of a peptide that inhibits the secretory activity of chromaffin cells (13). In addition, pancreastatin (248-293) is a peptide with multiple properties, since it negatively modulates insulin secretion from endocrine pancreatic islets (14, 15), amylase release from exocrine pancreas (16), and acid secretion from parietal cells (17). Another CGA-derived peptide, located in the C-terminal domain of CGA, parastatin (347-419), inhibits parathyroid cell secretion (18). In addition to the autocrine or paracrine role in hormone secretion of these CGA-derived peptides, we have recently shown that numerous peptides with antibacterial activity are present as water-soluble components of bovine chromaffin granules and are released during secretion (7, 19-22). For several antibacterial peptides derived from CGA and proenkephalin-A, structural features and more particularly post-translational modifications have been directly related to biological activity (20, 21).

CGA is a single polypeptide chain of 431 residues, with an apparent molecular mass of 70 kDa as estimated by SDS-polyacrylamide gel electrophoresis and a pI of 4.7-5.2 (6). The amino acid sequence of bovine CGA (23, 24) indicates a real molecular mass of 48 kDa for the unmodified form of this protein. The difference between the apparent (70 kDa) and theoretical molecular mass (48 kDa) probably results from post-translational modifications (i.e. glycosylation, phosphorylation, and sulfation) and the abundance of acidic residues (25%) that cause a slower migration during electrophoresis in the presence of sodium dodecyl sulfate (for a review, see Ref. 5). Previously, CGA has been described as a glycoprotein containing 5.4% carbohydrate (mass/mass), consisting of small glycan moieties (25); consensus sequences for N-glycosylation (NX(S/T)) are, however, not present in the primary structure (26). Furthermore, CGA has been described to be a phosphoprotein, with a ratio of five phosphorylated serine residues per protein molecule (27). There is a modest incorporation of sulfate into CGA (28), and it is bound to O-glycans and not to tyrosine residues (21, 29).

Recently, using a combination of gas chromatography and mass spectrometry, we described the oligosaccharide moiety to be present in CGA as trisaccharides including NeuAcalpha 2-3Galbeta 1-3GalNAcalpha 1 O-linked to a serine and/or threonine residue (21). Furthermore, studying the structural properties of new antibacterial CGA-derived peptides G- and PG-chromacin (CGA-(173-194)), the residue Ser186 was identified as an O-glycosylation site, and the tyrosine residue (Tyr173) was found to be phosphorylated. We also demonstrated that these two post-translational modifications are both necessary for the antibacterial activity of the CGA-(173-194) fragment.

The present paper deals with the complete determination of the phosphorylation and carbohydrate binding sites of CGA from bovine adrenal medullary chromaffin granules. The strategy consists of characterizing the structure of modified phosphorylated and O-glycosylated peptides that were isolated after proteolytic cleavage of CGA with endoproteinase Lys-C. We have performed a detailed study using separation by reverse phase HPLC, chemical modification of phosphorylated peptides, and complete analysis by sequencing and mass spectrometry using electrospray mass spectrometry (ES/MS), liquid chromatography/mass spectrometry (LC/MS), and matrix-assisted laser desorption-ionization time-of-flight (MALDI-TOF) mass spectrometry. Bovine CGA contains five phosphorylated residues located in four endoproteinase Lys-C-generated peptides (CGA-(173-194), CGA-(297-314), CGA-(78/79-109), and CGA-(331-420/421)) and two polysaccharide attachment sites linked to serine and threonine residues located within the CGA-(173-186) and CGA-(222-243) regions, respectively. The location of these sugar- and phosphate-rich peptides in the whole protein is specified in relation to the primary structure of bovine CGA. Sequence alignment of these modified peptides with CGA fragments of different species has led us to discuss these results in relation with phylogenetic features and specific physiological processing.


EXPERIMENTAL PROCEDURES

Purification of CGA- and CGA-derived Peptides

Secretory granules were isolated from bovine adrenal medulla (30), and soluble proteins were separated from membranes after osmotic shock-induced lysis and high speed centrifugation (31). CGA was purified by reverse phase HPLC on a Macherey Nagel Nucleosil 300-5C18 column (4 × 250 mm; particle size 5 mm and pore size 100 nm) with the Applied Biosystems HPLC system 140 B as described previously (7). Then CGA (10 nmol) was digested for 2 h at 37 °C with endoproteinase Lys-C at a protein:proteinase weight ratio of 1000:1 in 100 mM Tris-HCl, pH 8.3. Generated peptides were then separated on a Macherey Nagel 300-5C18 column. Absorbance was monitored at 214 nm, and the solvent system consisted of 0.1% trifluoroacetic acid in water (solvent A) and 0.1% trifluoroacetic acid, 30% water, 69.9% acetonitrile (solvent B). Material was eluted at a flow rate of 0.7 ml/min using, successively, a gradient of 0-25% B in A over 10 min followed by a gradient of 25-75% over 50 min. Each peak fraction was manually collected and concentrated by evaporation, but not to dryness.

Sequence Analysis

The sequence of purified CGA-derived peptides was determined in our laboratory by automatic Edman degradation on an Applied Biosystems 473 A microsequencer. Samples (100 pmol) were loaded onto polybrene-treated and precycled glass fiber filters (6). To identify phosphorylated residues, samples were modified with ethanethiol according to the method previously described (32). Before sequencing, reagents were removed, using the ProSorbTM sample preparation cartridge (Applied Biosystems, division of Perkin-Elmer).

Mass Spectrometry Analysis

ES/MS

ES/MS analysis was done on a VG Bio-Q quadrupole mass spectrometer (Fisons Bio-Q; VG Bio-Tech) with a mass range of 4000 Da and operating in the positive ion mode (33). The peptide was dissolved in water/acetonitrile/acetic acid (49/50/1; v/v/v) at a concentration of about 2-5 pmol/µl. Aliquots (10 µl) were introduced into the ion source at a flow rate of 4 µl/min. Scanning was usually performed from m/z = 500 to m/z = 1500 in 10 s with the resolution adjusted so that the peak at m/z = 998 from heart myoglobin was 1.5-2 wide on the base. Calibration was performed using the multiply charged ions produced by a separate introduction of horse heart myoglobin (16950.4 Da).

LC/MS

In order to isolate and characterize glycopeptides, we have performed LC/MS analysis of CGA-derived peptides obtained after endoproteinase Lys-C digestion of CGA. Then, CGA (500 pmol) was digested for 2 h at 37 °C with endoproteinase Lys-C at a protein-to-proteinase weight ratio of 1000:1 in 100 mM Tris-HCl, pH 8.3. Then peptides were separated with an HPLC system (Applied Biosystems 140 A solvent delivery system) equipped with a UV detector (UV Waters detector 386) on a narrowbore Macherey Nagel Nucleosil 300-5C18 column (2 × 150 mm). Absorbance was monitored at 214 nm, and the solvent system consisted of 0.1% trifluoroacetic acid/water (solvent A) and 0.1% trifluoroacetic acid/acetonitrile (solvent B). Material was eluted at a flow rate of 250 µl using a gradient of 0-80% B in A over 80 min. A major part of the eluent (90%) was analyzed by UV detection, and an aliquot (10%) was measured by LC/MS (34). The mass spectrometer was calibrated under conditions using a mixture of polyethylene glycols (average masses 400 and 2000 Da). Spectra were scanned over m/z 320-1800 for 6 s, and the total ion current was recorded.

MALDI-TOF Mass Spectrometry

This mass spectrometry analysis was carried out on a Brucker BIFLEXTM matrix-assisted laser time-of-flight mass spectrometer equipped with the ScoutTM high resolution optics with an X-Y multisample probe, a gridless reflector, and the HIMASTM linear detector. This instrument has a maximum accelerating potential of 30 kV and may be operated either in the linear or reflector mode. Ionization was accomplished with a 337-nm beam from a nitrogen laser with a repetition rate of 3 Hz. The output signal from the detector was digitized at a sampling rate of 250 MHz in linear mode and 500 MHz in reflector mode using a 1-GHz digital oscilloscope (Lecroy model). The instrument control and data processing were accomplished with software supplied by Brucker using a Sun Sparc workstation. These studies were realized according to the procedure previously described (21).

Sequence Comparisons

Sequence alignment of bovine CGA sequences with corresponding fragments of CGA from different species was performed using the Clustal V multiple sequence alignment program (35). Chromogranin sequences were retrieved from the Swiss-Prot data base.


RESULTS

In order to determine phosphorylation and glycosylation sites included within the bovine CGA sequence, the protein was purified according to the procedure previously described (21) and digested by endoproteinase Lys-C (see "Experimental Procedures"). The generated fragments were separated by HPLC on a reverse-phase C18 column. Our purpose was to identify peaks eluting at different times but containing peptides sharing identical peptidic sequences. The various elution times of these peptides indicated differences due to post-translational modifications. Taking into account these parameters, the chromatogram was divided into five regions from I to V (Fig. 1).


Fig. 1. Isolation by HPLC of CGA-derived peptides generated after endoproteinase Lys-C digestion. A, elution profile of the endoproteinase Lys-C digest on a Macherey Nagel reverse-phase Nucleosil 300-5C18 column (4 × 250 mm). Absorbance was monitored at 214 nm, and elution was performed with a linear gradient as indicated on the right scale. The five areas (see "Results") named I, II, III, IV, and V are indicated. B, the different peaks present in each area, I to IV, are shown.
[View Larger Version of this Image (26K GIF file)]

Identification of Phosphorylation Sites on CGA Protein

Structural Characterization of Phosphorylated Peptides Present in Area I Peaks

The four peaks present in region I corresponding to chromacin-derived peptides previously characterized as CGA-(173-194) (YPGPQAKEDSEGPSQGPASREK) (21). The N-terminal Tyr173 has already been identified as one of the phosphorylation sites (21).

Structural Characterization of Phosphorylated Peptides Present in Area III Peaks

After automatic Edman degradation of peptide material recovered in peaks 1 and 2 of region III, we identified a major fragment with the sequence SGEPEQEEQLSKEWEDAK that corresponds to CGA-(297-314). To determine the post-translational modification of the more polar peptide (peak 1), comparative mass spectra analysis was performed by ES/MS (Fig. 2). Using the MacPro Mass program, the theoretical molecular mass of this peptide was estimated to be 2118.8 Da, corresponding to the experimental mass of the peptide recovered in peak 2. In contrast, the 2198.8-Da molecular mass of the peptide in peak 1 with a value of 2198.8 Da represents a difference of 80 Da, suggesting a phosphorylated serine residue, either Ser297 or Ser307. The material present in peak 1 was treated with alkaline phosphatase; this removed a mass of 80 Da, confirming the presence of a phosphate group. To identify which serine residue was phosphorylated, the peptide was submitted to the Meyer modification in the presence of ethanethiol prior to sequencing (32). A phenylthiohydantoin-S-ethylcysteine was identified in position 307. 


Fig. 2. Electrospray ionization mass spectrometry analysis of the CGA-derived peptides present in peak 1 of area III. A, a component recovered in A2 and A3 was identified as CGA-(297-314) with an experimental molecular mass of 2198.8 Da, while the calculated molecular mass was 2118.8 Da. In addition, a component recovered in B1 and B2 with a molecular mass of 1185.3 Da corresponds to CGA-(60-70) with a calculated molecular mass of 1186.4 Da. B, primary structure of the phosphorylated fragment CGA-(297-314); S*, phosphorylated serine residue.
[View Larger Version of this Image (25K GIF file)]

Sequencing and mass spectra analysis of peak 1 material indicated the presence of an additional peptide corresponding to CGA-(60-70). The experimental molecular mass of 1185.3 Da corresponds to the theoretical molecular mass of the unmodified form of this peptide.

Structural Characterization of Phosphorylated Peptides Present in Area IV Peaks

Sequencing and mass spectrometry analysis of the material in the peaks of region IV revealed two groups of two peptides. After sequencing, the four peptides (numbered 1-4; Fig. 1) were identified as CGA fragments corresponding, respectively, to CGA-(78-109) (KHSSYEDELSEVLEKPNDQAEPKEVTEEVSSK) (peaks 1 and 3) and CGA-(79-109) (HSSYEDELSEVLEKPNDQAEPKEVTEEVSSK) (peaks 2 and 4). To characterize the structural differences between the peptides in peaks 1 and 3 and those in peaks 2 and 4, they were analyzed by mass spectrometry (Fig. 3). A theoretical molecular mass of fragments 78-109 and 79-109 was calculated to be 3662.9 and 3534.7 Da, respectively. Experimental molecular masses of peptides in peaks 2 and 4 fitted with these values, indicating that these were unmodified peptides. In contrast, the molecular mass of peptides in peaks 1 and 3 were evaluated to be 3741.63 Da and 3613.50 Da, showing an additional mass of 80 Da. CGA fragment 78-109 included seven potential phosphorylation sites (Ser80, Ser81, Tyr82, Ser87, Thr103, Ser107, and Ser108).


Fig. 3. Electrospray ionization mass spectrometry analysis of CGA-derived peptides contained in peaks 1-4 of area IV. Peak 1, a component recovered in A3, A4, and A5 with an experimental molecular mass of 3741.63 Da was identified as modified CGA-(78-109). Peak 2, a component recovered in A3 and A4 with an experimental mass of 3613.50 Da was identified as modified CGA-(79-109). B3/B4, experimental molecular mass of contamination. Peak 3, a component recovered in A3, A4, and A5 with an experimental molecular mass of 3661.86 Da corresponds to CGA-(78-109). Peak 4, a component recovered in A3 and A4, with an experimental molecular mass of 3533.65 Da corresponds to CGA-(79-109). S*, phosphorylated serine residue.
[View Larger Version of this Image (27K GIF file)]

Upon treatment with alkaline phosphatase, peptide 1 lost 80 Da, confirming the presence of a phosphate group. Location of the phosphorylated residue was determined after ethanethiol derivatization and microsequencing; a phenylthiohydantoin-S-ethylcysteine was identified in position Ser81.

Structural Characterization of Phosphorylated Peptides Contained in Area V Peaks

The first 23 amino acids of the major peptide (>90%) recovered in region V were sequenced as RLEGEEEEEEDPDRSMRLSFRAR. This sequence corresponds to the CGA fragment beginning at position 331 and results from a cleavage of the Lys330-Arg331 residues. Mass spectra analysis showed the presence of four molecular species with molecular masses of 2741.26, 7859.43, 10578.03, and 10677.50 Da (Fig. 4). The lower molecular mass may be assigned to the fragment 332-354, with a theoretical molecular mass of 2738.90 Da. We then focused on the higher molecular mass components. The calculated mass difference between 10677.50 and 10578.03 Da suggested the presence of a valine residue (99 Da) at the C-terminal end of the peptide. Taking into account the N-terminal sequence, the molecular mass, and the presence of C-terminal valine, we speculated that the CGA fragments 331-420/421 with calculated molecular masses of 10418.3 and 10517.5 Da probably correspond to the unmodified peptides eluting in peaks of region V. Comparing the experimental masses (10578.03 and 10677.50 Da) with theoretical values, a difference of 160 Da was obtained, suggesting the presence of two phosphorylated residues. Indeed, this fragment CGA-(331-420/421) possesses nine potential phosphorylation sites Ser345, Ser349, Tyr355, Ser372, Ser376, Tyr388, Ser398, Ser410, and Ser412.


Fig. 4. Electrospray ionization mass spectrometry analysis of CGA-derived peptides present in area V. A, a component recovered in A8-A15, with an experimental molecular mass of 10578.03 Da was identified as modified CGA-(331-420); a component recovered in B3 and B4, with an experimental molecular mass of 2741.26 Da corresponds to CGA-(332-354); a component recovered in C6-C9, with an experimental molecular mass of 7859.43 Da was identified as modified CGA-(354-421); a component recovered in D8-D14, with an experimental molecular mass of 10677.50 Da was identified as modified CGA-(331-421). B, primary structure of modified CGA-derived fragments 331-420/421; S*, phosphorylated serine residues.
[View Larger Version of this Image (35K GIF file)]

To characterize the two sites with post-translational modifications, a mixture of peptides 331-420 and 331-421 was treated with alkaline phosphatase. After this treatment, mass spectra analysis revealed the presence of two peptides with respective molecular masses of 10418.30 Da and 10517.30 Da instead of 10578.03 and 10677.50 Da. This observed mass loss of 160 Da confirmed the presence of two phosphate groups on both peptides.

After tryptic digestion of the peptides 331-420 and 331-421, the two phosphorylated residues were identified. The generated peptides were separated by HPLC (Fig. 5), and their primary structure was determined from microsequencing and MALDI-TOF analysis (Fig. 5B). By comparing the experimental and calculated molecular mass of peptide CGA-(367-386) (2430.2 versus 2267.5 Da), the addition of 160 Da indicated the phosphorylated residues on this peptide. After derivatization of the GWRPNSREDSVEAGLPLQVR peptide with ethanethiol, it was unambiguously demonstrated that the phosphorylated residues were located in positions Ser372 and Ser376.


Fig. 5. Purification and structural characterization of the modified tryptic peptide CGA-(367-386). Material included in area V (Fig. 1) and corresponding to CGA-(331-420/421) was submitted to tryptic digestion. A, elution profile of the tryptic digest by chromatography on a Macherey Nagel reverse-phase Nucleosil 300-5C18 column (4 × 250 mm). Absorbance was monitored at 214 nm, and elution was performed with a linear gradient as indicated on the right scale. The arrow shows the peak containing the modified peptide. B, MALDI-TOF mass spectrometry of the modified fragment with an experimental molecular mass of 2430.2 Da and corresponding to modified fragment CGA-(367-386). C, primary structure of bisphosphorylated peptide CGA-(367-386). S*, phosphorylated serine residues.
[View Larger Version of this Image (20K GIF file)]

Thus, the peptide with the experimental molecular mass of 7859.43 Da (Fig. 4A) probably corresponds to the bisphosphorylated CGA fragment 357-421 (calculated molecular mass 7698.40 Da).

Location of the Five Phosphorylated Residues of Bovine CGA along the Polypeptide Chain

The location of the observed phosphorylated residues of CGA along the CGA backbone are represented in Fig. 6. The present data indicate that (i) four of the phosphorylated residues are located on serines at positions Ser81, Ser307, Ser372, and Ser376, (ii) two of those serine residues at positions Ser81 and Ser307 belong to glutamic acid-rich sequences (SS81YEDELESEVLE and EPEQEEQLS307KEWE), (iii) one phosphorylation site is present on a tyrosine residue at position Tyr173, (iv) this phosphorylated Tyr173 is included in the proline-rich sequence LPSPKY173PGPQAKEDSEGPSQGP, (v) as far as can be determined with the technology used in the present work, there are no more than five phosphorylation sites per bovine CGA molecule.


Fig. 6. Schematic representation of post-translational modifications included within bovine CGA polypeptide chain. In panel A, S, T, and Y represent serine, threonine, and tyrosine residues. P, phosphorylated sites on positions Ser81, Tyr173, Ser307, Ser372, and Ser376. GalNAc, Gal, and NeuAc O-glycosylated sites on positions Ser186 and Thr231 are shown. Panel B, chemical structure of the trisaccharide NeuAcalpha 2-3-Galbeta 1-3GalNAcalpha 1 O-linked to Ser186 and Thr231.
[View Larger Version of this Image (18K GIF file)]

Identification of O-Glycosylation Sites

From structural properties of unmodified and modified CGA-(173-194) chromacin peptide, we have previously shown that bovine CGA contains at least one trisaccharide moiety with the NeuAcalpha 2-3Galbeta 1-3GalNAcalpha 1 sugar sequence (21). G- and PG-chromacin (glycosylated and phosphorylated/glycosylated chromacin) are O-glycosylated peptides in which Ser186 is the residue to which the sugars are linked.

To further characterize other glycosylated fragments present on CGA, the protein was digested with endoproteinase Lys-C and analyzed by LC/MS.

LC/MS Analysis of Endoproteinase Lys-C-generated Fragments

In Fig. 7, the HPLC chromatogram (A), the single ion recording (SIR) of specific ions characteristic of glycosylation sites (B), and the total ionic current (TIC) of the chromatogram (C) are shown. In B, the presence of O-glycosylated peptides were recovered in peaks of regions I and II (Fig. 1). Analysis of region I has been previously reported with the characterization of G- and PG-chromacin (21).


Fig. 7. On-line LC/MS of the endoproteinase Lys-C digest of bovine CGA. Endoproteinase Lys-C digest of bovine CGA (500 pmol) was analyzed by LC/MS (narrowbore with postcolumn split), as described under "Experimental Procedures." In panel A, the y axis represents the absorbance at 214 nm (0.2 absorbance units as full scale), and the x axis indicates the elution time of the different fractions. Panel B, single ion recording specific to glycopeptides (SIR). Panel C, specific total ion current (TIC).
[View Larger Version of this Image (27K GIF file)]

Structural Characterization of O-Glycosylated Peptides Contained in Area II Peaks

Sequencing of material included in the three peaks eluting in region II indicates the presence of a peptide corresponding to CGA-(222-243). Automatic Edman degradation of peak 3 (Fig. 1B) indicates that Thr231 was not detectable, suggesting an O-linked attachment site. To confirm this hypothesis, this peptide was analyzed by ES/MS (Fig. 8A). The data show three different molecular species with respective molecular masses of 2262.65, 2627.45, and 2919.45 Da. The molecular mass of 2262.65 Da might be attributed to the unmodified fragment CGA-(222-243), while the other species are likely to be the glycosylated forms of the same peptide (Fig. 8B). The molecular masses of 2919.45 and 2627.45 Da corresponded, respectively, to the O-glycosylated peptide with the trisaccharide NeuAcalpha 2-3Galbeta 1-3GalNAcalpha 1 moiety and to the disaccharide after the loss of terminal sialic acid.


Fig. 8. Electrospray ionization mass spectrometry of CGA-derived peptides present in peak 3 of area II. A, a component recovered in A2 and A3 with an experimental molecular mass of 2919.45 Da was identified as O-glycosylated CGA-(222-243) with the trisaccharide NeuAcalpha 2-3-Galbeta 1-3GalNAcalpha -1; a component recovered in B2 and B3 with an experimental mass of 2627.45 Da was identified as O-glycosylated CGA-(222-243) with the disaccharide Galbeta 1-3GalNAcalpha -1; a component recovered in C2 and C3 with an experimental mass of 2262.65 Da corresponds to the CGA-derived peptide CGA-(222-243). B, primary structure of modified CGA-derived fragments CGA-(222-243). T*, O-glycosylated threonine residue with the trisaccharide NeuAcalpha 2-3-Galbeta 1-3GalNAcalpha -1 and; T+, O-glycosylated threonine residue with the disaccharide Galbeta 1-3GalNAcalpha -1.
[View Larger Version of this Image (28K GIF file)]

Location of the Two O-Glycosylation Sites of Bovine CGA within the Polypeptidic Chain

A schematic representation of bovine CGA showing the two O-linked carbohydrate attachment sites Ser186 and Thr231 located in the middle part of the whole protein is given in Fig. 6. The sequence in the vicinity of the serine residue Ser186 (PSQGP) fits with the two characteristic sequence patterns described by Wilson (36) for O-glycosylation sites. In contrast, the fragment 222-243 around threonine residue Thr231 is a proline-rich sequence (40%) but lacks of the Wilson consensus pattern.


DISCUSSION

Chromogranins A and B occur in multiple secretory cell types of numerous species within the animal kingdom (1, 37-40). Multiple neuroendocrine sources other than the adrenal medulla appear to contribute to the high basal circulating CGA concentration in man (1). The widespread occurrence of CGA is indicative of some important biological roles for this protein. Despite the fact that CGA has been widely studied since its discovery 30 years ago, the characterization of possible functions is still an open question.

On the basis of secondary and tertiary structures predicted from its primary structure, CGA possesses a "random coil" structure (1). In addition, according to Kyte and Doolittle predictions (41), this protein is very hydrophilic throughout the length of its polypeptide (6). This is in accordance with its biochemical properties, and in particular with the observation that CGA remains soluble after boiling for several minutes (29). Concerning the post-translational modifications, CGA has previously been described to be a glycophosphoprotein containing small O-glycosidically linked carbohydrate moieties (25) and five phosphorylated residues (27). Besides the 70-kDa molecular species, several observations have reported the presence of an SDS 80-90-kDa diffuse form of chromogranin A immunoreactivity as full-length chromogranin A-core proteoglycan in secretory granules from bovine adrenal medulla and from PC12 cells (42). The functional significance of this proteoglycan in hormone storage vesicles is unknown. Furthermore, several studies have documented the presence of other post-translational modifications on the CGA molecule including methylation via protein carboxymethylase (43, 44) and transglutamination (45, 46).

In the present paper, we report for the first time the full characterization of seven post-translational modifications that are present along the polypeptide chain of CGA from bovine chromaffin granules. Five phosphorylated residues were found to be on residues Ser81, Tyr173, Ser307, Ser372, and Ser376. This finding is in agreement with the quantification of the phosphorylated residues previously reported (27). The novel interesting observation was the presence of a phosphorylated tyrosine residue. Tyrosine phosphorylation is not a common post-translational modification, since it represents only 0.03% of the phosphorylated amino acids in normal cells (47). The significance of this tyrosine phosphorylation is not yet known, although we have recently reported that chromacin, the CGA-derived peptide 173-194, displays antibacterial activity when the N-terminal tyrosine 173 residue is phosphorylated (21). On the basis of a protein consensus domain specific to kinases, it is possible to predict that protein kinase C may introduce a phosphate group on residues Ser81, Ser372, and Ser376, while protein kinase A may modify residue Ser307 and in addition Ser372 and Ser376. These two protein kinase activities have previously been characterized within the chromaffin intragranular matrix (48-50), although their significance is still unknown. More recently, the presence of an isoform of CaM kinase II in bovine adrenal medullary cells was reported, and purified CGA was found to be a substrate to cyclic AMP-dependent protein kinase, to protein kinase C as well as to CaM kinase II (51). Furthermore, a close relationship between CaM kinase II activation, catecholamine secretion, and tyrosine hydroxylase activation in cultured adrenal medullary cells was demonstrated. Thus, sequential CGA post-translational phosphorylation may take place either at early steps prior to its incorporation into granule or within the secretory granule itself.

Concerning the O-glycosylation sites included on bovine adrenal medullary CGA, we had previously located a unique carbohydrate moiety composed of the trisaccharide NeuAcalpha 2-3Galbeta 1-3GalNAcalpha 1 on the serine residue Ser186 (21). In the present work, we identified a second trisaccharide attachment site on residue Thr231. From mass spectrometry, it appeared that these two residues were the only ones with carbohydrate moieties. In 1991, Wilson (36) described the structural requirements for the addition of O-linked N-acetyl galactosamine to proteins; the most prominent feature in the vicinity of O-glycosylated sites is the significantly increased frequency of proline residues, especially at positions -1 and +3 relative to the glycosylated residue (i.e. PX1X2P). In contrast with chromacin, the glycopeptide 173-194, which has the characteristic sequence pattern PX1X2P surrounding Ser186, the second glycosylation site in the peptide 222-243 (AVPEEESPPAAFKPPPSLGNK) has the sequence PPXXXXPPP surrounding Thr231. Although Wilson sequence is absent in this peptide, the occurrence of multiple proline residues may represent a characteristic feature. The presence of these two trisaccharides on bovine adrenal medullary CGA gives rise to a calculated sugar:protein ratio of 2.7%; this value corresponds to half of the sugar content that has previously been reported (25). This difference is probably due to the fact that the protein mass used for calculation was that determined from electrophoretic mobility, which was 2-fold higher than the true mass. From mass spectrometry analysis, we also identified glycopeptides 173-194 and 222-243 with the complete trisaccharide structure; the desialylated peptides and the glycan-free peptides were recovered. Approximately half of the CGA peptides are glycosylated, perhaps due to incompletely achieved post-translational modification in the Golgi apparatus prior to granule formation or due to the loss of carbohydrate residues during the purification of these peptides.

The phosphorylated residues are preferentially located on the N-terminal (Ser81 and Tyr173) and on the C-terminal (Ser307, Ser372, and Ser376) domains of the protein. In contrast, the two O-glycosylated residues Ser186 and Thr231 are localized in the central core of the protein. In 1993, two phosphorylated CGA-derived peptides were isolated from pancreas, pancreastatin (CGA-(248-294)) and CGA-(297-313) (52). Furthermore, in pancreatic CGA, the N-terminal residue Ser297 was found to be phosphorylated. As reported here, adrenal medullary CGA was not phosphorylated on this residue, revealing that phosphorylation of bovine CGA may be a tissue-specific process.

Natural Processing of CGA Is Related to Post-translational Modifications

The two post-translational glycosylations of CGA probably have a structurally related function. The two trisaccharide moieties are attached on residues Ser186 and Thr231, which are present in the central domain of the protein; this modification may prevent natural cleavage in this domain. The closest proteolytic sites have been identified on Arg115-Asp116 and Arg247-A248 (6). This CGA proteolysis gives rise to a long glycopeptide of 132 residues containing the two sugar moieties.

In the C-terminal domain, the phosphorylated residues Ser307, Ser372, and Ser376 can be assumed to prevent the natural cleavage on dibasic sites 314-315 and 366-367, since no corresponding peptides have been found (6). However, cleavage of the unphosphorylated form can generate low amounts of minor fragments beginning at residue 316.

Location of the O-Glycosylation and Phosphorylation Sites on Bovine CGA in Relation to Biological Active Peptides

Present results revealed that two of the post-translational modifications on bovine CGA are detected on derived peptides that inhibit hormone and neurotransmitter release: (i) CGA-(1-113) containing phosphorylated Ser81 corresponds to the vasostatin II sequence (10) and is homologous to pancreatic rat betagranin (9), and (ii) the natural fragment CGA-(347-419) bearing phosphorylated Ser372 and Ser376 is parastatin (18). Previously, both CGA and pancreastatin were shown to inhibit low Ca2+-stimulated parathyroid cell secretion (53, 54). The N-terminal fragment, named betagranin, corresponding to the CGA-(1-113) peptide has been shown to inhibit parathyroid hormone secretion stimulated by low calcium concentrations (8). This fragment is generated naturally in several endocrine tissues, notably the adrenal medulla (10, 12, 55), pituitary (56), endocrine pancreas (9), and parathyroid glands (8). Another CGA-derived fragment, named parastatin, located in the C-terminal domain and corresponding to CGA-(347-419), strongly inhibits low Ca2+-stimulated parathyroid secretion. Vasostatins, and more particularly vasostatin I, corresponding to CGA-(1-76) were described to inhibit the potent vasoconstrictor peptide, endothelin-1. It is not yet known whether phosphorylation is important for the biological activity of these CGA-derived fragments.

Concerning the O-glycosylation and phosphorylation modifications, we have recently reported that they are necessary for the full antibacterial activity of chromacin peptides. The natural CGA-derived antibacterial peptide, prochromacin CGA-(79-431), included the seven modifications. We have previously established that the antibacterial activity of chromacin CGA-(173-186) is correlated with the presence of O-glycosylation modification on Ser186 and/or phosphorylation on Tyr173 (21).

In addition, the region CGA-(305-309) contains a specific Ca2+-binding domain including the phosphorylated Ser307 residue. Again, the presence of phosphate group may affect the binding of calcium.

Phylogenic Features Related to the Location of O-Glycosylation and Phosphorylation Sites within Bovine CGA

In Table I, we report the bovine CGA regions (24) where post-translationally modified residues are present and compare them with the corresponding sequences of human (57, 58), pig (59), mouse (60), and rat (61) species and the N-terminal domain of the ostrich CGA sequence (62). The three phosphorylated residues Ser307, Ser372 and Ser376 are strictly conserved and included in homologous sequences with the typical pattern (E/Q)(E/Q)EE(R/Q)LS307(R/K/E)EWE(D/N) and R(P/R)(S/N/G)S372R(E/P)(D/N)S376(V/W)E. Furthermore, Ser81 is present in bovine, porcine, mouse, and rat CGA and changed in threonine residue in ostrich CGA sequence, whereas in the human CGA sequence Ser81 is changed into Gly on (Q/T)(Q/E)(Q/K)(H/Q/R)(S/R)(S/G/T)81(F/Y/E)(E/D)(D/Q)EL sequence. However, in the human CGA sequence the adjacent amino acid in position 80 is a serine residue that could represent the phosphorylation site. In contrast, the phosphorylated tyrosine residue Tyr173 is restricted to bovine and human CGAs; the sequence PS(P/Q)KY173PGPQAK is homologous in both species. In pig, mouse, and rat, Tyr173 is changed into arginine or histidine, and no tyrosine residue is present in the immediate vicinity.

Table I. Sequence comparison of bovine CGA-derived peptides including post-translational modifications (CGA-(75-86), CGA-(169-189), CGA-(222-238), CGA-(299-312), CGA-(367-385)) and the corresponding CGA-derived fragments of several species

CGA sequences were retrieved from the Swiss-Prot database: CGAb (bovine; P05059; Ref. 24), CGAh, (human; P10645; Refs. 57 and 58), CGAp (pig; P04404; Ref. 59), CGAm (mouse; P26339; Ref. 60), CGAr (rat; P10354; Ref. 61), CGAo (ostrich; P33716; Ref. 62). Identical residues and conservative changes in positions corresponding to modified residues are in boldface type. The consensus O-glycosylated sequence according to Wilson (36) is underlined. CGA sequences were retrieved from the Swiss-Prot database: CGAb (bovine; P05059; Ref. 24), CGAh, (human; P10645; Refs. 57 and 58), CGAp (pig; P04404; Ref. 59), CGAm (mouse; P26339; Ref. 60), CGAr (rat; P10354; Ref. 61), CGAo (ostrich; P33716; Ref. 62). Identical residues and conservative changes in positions corresponding to modified residues are in boldface type. The consensus O-glycosylated sequence according to Wilson (36) is underlined.
               81                        173                                186
CGAb Q Q K K H S S Y E D E L  P S P K Y P G P Q A K E D S E --- G 
CGAh Q Q K K H S G F E D E L  P S Q K Y P G P Q A K G D S E --- G L S Q G L
CGAp Q Q K K Q S S Y E D E L  P S K K R P G A Q A E E D H E --- G 
CGAm Q E Q Q H S S F E D E L  P S Q E H V D P Q A T G D S E R G L S A Q Q
CGAr Q Q Q Q H S S F E D E L  P S Q E H G I P Q T T E G S E R G P S A Q Q
CGAo T Q Q Q R R T E D Q E L
                 231                                307
CGAb A V P E E E S P P T A A F K P P P    E P E Q E E Q L S K E W E D
CGAh A V P E E E G --- P T V V L N P H P    L E Q E E E R L S K E W E D
CGAp A V P E E E G P R S E A F D S H P    A Q E E E E R L S E E W E N
CGAm A G P E E V --- --- P T A A S S S H F    E E E E E E R L S R E W E D
CGAr A G P K E V --- --- P T A A S S S H F    E E E E E E R L S R E W E D
         372     376
CGAb G W R P N S R E D S V E A G L P L Q V
CGAh Q L R R G S R P N S W E D S L E A G L
CGAp G W R P S S R E D S V E A G L P L Q V
CGAm G W R P S S R E D S V E A R S D F E E
CGAr G W R P S S R E D S V E A R G D F E E

The attachment O-glycosylation site Ser186 is highly conserved in bovine, human, porcine, mouse, and rat CGAs, but the Wilson consensus pattern PS186QGP is conservative in bovine and pig CGAs, whereas important variation is present in human, mouse, and rat protein. Concerning the second O-glycosylated site, the residue Thr231 is present in bovine, human, mouse, and rat CGAs. In pig, this threonine is changed into a serine residue, which might be a phosphorylation site. With regard to the Wilson consensus sequence (36), the importance of proline residues in the vicinity of Thr231 is not known. They are present upstream and downstream in the bovine, human, and pig sequences but are scarce in rat and mouse CGAs.

Location of O-Glycosylation and Phosphorylation Sites of Bovine CGA in Relation to Antigenic Sites of Human CGA

Recently, the most antigenic sites of recombinant human CGA have been characterized and have been correlated with the location of the different biological active fragments derived from human chromogranin (63). Taking into account the high degree of homology between the bovine and human CGA proteins, it was of interest to correlate the location of these antigenic sites with the modified residues. The post-translational modified residues in positions 81, 231, 307, 372, and 376 appear to be preferentially located in or near domains with high antigenicity (68-106, 222-230, 315-330, and 376-394), whereas only two modified residues in positions 173 and 186 are located in the 163-210 region described to have low antigenicity. This result indicates that post-translational modifications are located outside of highly antigenic domains, thus suggesting important, potential biological roles for the O-linked-trisaccharide and phosphorylated residues.


FOOTNOTES

*   This work was supported by the French Direction des Recherches, Etudes et Techniques (DRET 93-104), the Université Louis-Pasteur of Strasbourg (Contrat Quadriennal 92-95 to INSERM Unit U.338) and the Institut National de la Santé et de la Recherche Médicale (Equipements Lourds to INSERM U.338).The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
   To whom correspondence should be addressed: Dr. Marie-Hélène Metz-Boutigue, Unité INSERM U-338, 5 rue Blaise Pascal, 67084 Strasbourg Cedex, France. Tel.: 33-3-88-45-67-19; Fax: 33-3-8860-08-06.
1   The abbreviations used are: CGA, chromogranin A; ES/MS, electrospray mass spectrometry; LC/MS, liquid chromatography/mass spectrometry; MALDI-TOF, matrix-assisted laser desorption ionization time-of-flight; HPLC, high pressure liquid chromatography.

ACKNOWLEDGEMENTS

We express our sincere gratitude to Dr N. Grant for improvement of the manuscript.


REFERENCES

  1. Simon, J. P., and Aunis, D. (1989) Biochem. J. 262, 1-13 [Medline] [Order article via Infotrieve]
  2. Helle, K. B. (1990) Neurochem. Int. 17, 165-175 [CrossRef]
  3. Huttner, W. B., Gerdes, H. H., and Rosa, P. (1991) Trends Biochem. Sci. 16, 27-30 [CrossRef][Medline] [Order article via Infotrieve]
  4. Winkler, H., and Fischer-Colbrie, R. (1992) Neuroscience 49, 497-528 [CrossRef][Medline] [Order article via Infotrieve]
  5. Dillen, L., Miserez, B., Claeys, M., Aunis, D., and De Potter, W. (1993) Neurochem. Int. 22, 315-352 [CrossRef][Medline] [Order article via Infotrieve]
  6. Metz-Boutigue, M. H., Garcia-Sablone, P., Hogue-Angeletti, R., and Aunis, D. (1993) Eur. J. Biochem. 217, 247-257 [Medline] [Order article via Infotrieve]
  7. Strub, J. M., Garcia-Sablone, P., Lonning, K., Taupenot, L., Hubert, P., Van Dorsselaer, A., Aunis, D., and Metz-Boutigue, M. H. (1995) Eur. J. Biochem. 229, 356-368 [Medline] [Order article via Infotrieve]
  8. Drees, B. M., Rouse, J., Johnson, J., and Hamilton, J. W. (1991) Endocrinology 129, 3381-3387 [Abstract/Free Full Text]
  9. Hutton, J. C., Davidson, H. W., and Peshavaria, M. (1987) Biochem. J. 244, 457-464 [Medline] [Order article via Infotrieve]
  10. Helle, K. B., Marley, P. D., Hogue-Angeletti, R., Galindo, E., Aunis, D., Small, D. H., and Livett, B. G. (1993) J. Neuroendocrinol. 5, 413-420 [CrossRef][Medline] [Order article via Infotrieve]
  11. Aardal, S., and Helle, K. B. (1992) Regul. Pept. 41, 9-18 [CrossRef][Medline] [Order article via Infotrieve]
  12. Aardal, S., Helle, K. B., Elsayed, S., Reed, R. K., and Serck-Hanssen, G. (1993) J. Neuroendocrinol. 5, 405-412 [CrossRef][Medline] [Order article via Infotrieve]
  13. Simon, J. P., Bader, M. F., and Aunis, D. (1988) Proc. Natl. Acad. Sci. U. S. A. 85, 1712-1716 [Abstract/Free Full Text]
  14. Tatemoto, K., Efendic, S., Mutt, V., Makk, G., Feistner, G. J., and Barchas, J. D. (1986) Nature 324, 476-478 [CrossRef][Medline] [Order article via Infotrieve]
  15. Efendic, S., Tatemoto, K., Mutt, V., Quan, C., Chang, D., and Ostenson, C. G. (1987) Proc. Natl. Acad. Sci. U. S. A. 84, 7257-7260 [Abstract/Free Full Text]
  16. Ishizuka, J., Asada, I., Poston, G., Lluis, F., Tatemoto, K., Greeley, G., and Thompson, J. (1989) Pancreas 4, 277-281 [Medline] [Order article via Infotrieve]
  17. Lewis, J. J., Goldenring, J. R., Asher, V. A., and Modlin, I. M. (1989) Biochem. Biophys. Res. Commun. 163, 667-673 [CrossRef][Medline] [Order article via Infotrieve]
  18. Fasciotto, B. H., Trauss, C. A., Greeley, G. H., and Cohn, D. V. (1993) Endocrinology 133, 461-466 [Abstract/Free Full Text]
  19. Strub, J. M., Hubert, P., Nullans, G., Aunis, D., and Metz-Boutigue, M. H. (1996) FEBS Lett. 379, 273-278 [CrossRef][Medline] [Order article via Infotrieve]
  20. Goumon, Y., Strub, J. M., Moniatte, M., Nullans, G., Poteur, L., Hubert, P., Van Dorsselaer, A., Aunis, D., and Metz-Boutigue, M. H. (1996) Eur. J. Biochem. 235, 516-525 [Medline] [Order article via Infotrieve]
  21. Strub, J.-M., Goumon, Y., Lugardon, K., Capon, C., Lopez, M., Moniatte, M., Van Dorsselaer, A., Aunis, D., and Metz-Boutigue, M.-H. (1996) J. Biol. Chem. 271, 28533-28540 [Abstract/Free Full Text]
  22. Metz-Boutigue, M. H., Strub, J. M., Goumon, Y. Lugardon, K. & Aunis D. (1997) Cell. Mol. Neurobiol., in press
  23. Benedum, U. M., Bauerle, P. A., Konecki, D. S., Franck, R., Powell, J., Mallet, J., and Huttner, W. B. (1986) EMBO J. 5, 1495-1502 [Medline] [Order article via Infotrieve]
  24. Iacangelo, A., Affolter, H.-U., Eiden, L. E., Herbert, E., and Grimes, M. (1986) Nature 323, 82-86 [CrossRef][Medline] [Order article via Infotrieve]
  25. Kiang, W.-L., Krusius, T., Finne, J., Margolis, R. U., and Margolis, R. K. (1982) J. Biol. Chem. 257, 1651-1659 [Free Full Text]
  26. Kornfeld, R., and Kornfeld, S. (1985) Annu. Rev. Biochem. 54, 631-664 [CrossRef][Medline] [Order article via Infotrieve]
  27. Settleman, J., Fonseca, R., Nolan, J., and Angeletti, R. H. (1985) J. Biol. Chem. 260, 1645-1651 [Abstract/Free Full Text]
  28. Falkensammer, G., Fischer-Colbrie, R., and Winkler, H. (1985) J. Neurochem. 45, 1475-1780 [CrossRef][Medline] [Order article via Infotrieve]
  29. Rosa, P., Hille, A., Lee, R. W. H., Zanini, A., De Camilli, P., and Huttner, W. B. (1985) J. Cell. Biol. 101, 1999-2011 [Abstract/Free Full Text]
  30. Smith, A. D., and Winkler, H. (1967) Biochem. J. 103, 483-492 [Medline] [Order article via Infotrieve]
  31. Aunis, D., Bouclier, M., Pescheloche, M., and Mandel, P. (1977) J. Neurochem. 29, 439-447 [CrossRef][Medline] [Order article via Infotrieve]
  32. Meyer, H. E., Hoffmann-Posorke, E., Korte, H., and Heilmeyer, L. M. G. (1986) FEBS Lett. 204, 61-66 [CrossRef][Medline] [Order article via Infotrieve]
  33. Jacquinod, M., Potier, N., Klarskov, K., Reymann, J. M., Sorokine, O., Kieffer, S., Barth, P., Andriantomanga, V., Biellmann, J. F., and Van Dorsselaer, A. (1993) Eur. J. Biochem. 218, 893-903 [Medline] [Order article via Infotrieve]
  34. Huddleston, M. J., Bean, M. F., and Carr, S. A. (1993) Anal. Chem. 65, 877-884 [Medline] [Order article via Infotrieve]
  35. Higgins, D. G., Bleasby, A. J., and Fuchs, R. (1992) Comput. Appl. Biosci. 8, 189-191 [Abstract/Free Full Text]
  36. Wilson, I. B. H., Gavel, Y., and Von Heijne, G. (1991) Biochem. J. 275, 529-534
  37. Rieker, S., Fischer-Colbrie, R., Eiden, L., and Winkler, H. (1988) J. Neurochem. 50, 1066-1073 [CrossRef][Medline] [Order article via Infotrieve]
  38. Reinecke, M., and Maake, C. (1993) Gen. Comp. Endocrinol. 90, 251-265 [CrossRef][Medline] [Order article via Infotrieve]
  39. D'Este, L., Buffa, R., Pelagi, M., Siccardi, A. G., and Renda, T. (1994) Cell Tissue Res. 277, 341-349 [Medline] [Order article via Infotrieve]
  40. Peterson, J. B., Nelson, D. L., Ling, E., and Angeletti, R. H. (1987) J. Biol. Chem. 262, 17264-17267 [Abstract/Free Full Text]
  41. Kyte, J., and Doolittle, R. F. (1982) J. Mol. Biol. 157, 105-132 [CrossRef][Medline] [Order article via Infotrieve]
  42. Barbosa, J. A., Gill, B. M., Takiyyuddin, M. A., and O'Connor, D. T. (1991) Endocrinology 128, 174-190 [Abstract/Free Full Text]
  43. Nguyen, M. H., Harbour, D., and Gagnon, C. (1987) J. Neurochem. 49, 38-44 [CrossRef][Medline] [Order article via Infotrieve]
  44. Diliberto, E. J., Viveros, O. H., and Axelrod, J. (1976) Proc. Natl. Acad. Sci. U. S. A. 73, 4050-4054 [Abstract/Free Full Text]
  45. Flanagan, T., Taylor, L., Poulter, L., Viveros, H., and Diliberto, E. (1990) Cell. Mol. Neurobiol. 10, 507-523 [CrossRef][Medline] [Order article via Infotrieve]
  46. Dillen, L., Boel, S., De Potter, W., and Claeys, M. (1992) Biochim. Biophys. Acta 1120, 105-112 [CrossRef][Medline] [Order article via Infotrieve]
  47. Sefton, B. M., Hunter, T., Beemon, K., and Eckart, W. (1980) Cell 20, 807-816 [CrossRef][Medline] [Order article via Infotrieve]
  48. Parsons, S. J., and Creutz, C. E. (1986) Biochem. Biophys. Res. Commun. 134, 736-742 [CrossRef][Medline] [Order article via Infotrieve]
  49. Burgoyne, R. D., Geisow, M. J., and Barron, J. (1982) Proc. R. Soc. Lond. B. Biol. Sci. 216, 111-115 [Medline] [Order article via Infotrieve]
  50. Treiman, M., Weber, W., and Gratzl, M. (1983) J. Neurochem. 40, 661-669 [CrossRef][Medline] [Order article via Infotrieve]
  51. Yanagihara, N., Oishi, Y., Yamamoto, H., Tsutsui, M., Kondoh, J., Sugiura, T., Miyamoto, E., and Izumi, F. (1996) J. Biol. Chem. 271, 17463-17468 [Abstract/Free Full Text]
  52. Watkinson, A., and Dockray, G. J. (1992) Regul. Pept. 40, 51-61 [CrossRef][Medline] [Order article via Infotrieve]
  53. Fasciotto, B. H., Gorr, S. U., De Franco, D. J., Levine, M. A., and Cohn, D. V. (1989) Endocrinology 125, 1617-1622 [Abstract/Free Full Text]
  54. Fasciotto, B. H., Gorr, S. U., Bourdeau, A. M., and Cohn, D. V. (1990) Endocrinology 127, 1329-1335 [Abstract/Free Full Text]
  55. Wohlfarter, T., Fischer-Colbrie, R., Angeletti, R., Eiden, L., and Winkler, H. (1988) FEBS Lett. 231, 67-70 [CrossRef][Medline] [Order article via Infotrieve]
  56. Huttner, W. B., and Benedum, U. M. (1987) Nature 325, 305 [Medline] [Order article via Infotrieve]
  57. Konecki, D. S., Benedum, U. M., Gerdes, H.-H., and Huttner, W. B. (1987) J. Biol. Chem. 262, 17026-17030 [Abstract/Free Full Text]
  58. Helman, L. J., Ahn, T. G., Levine, M. A., Allison, A., Cohen, P. S., Cooper, M. J., Cohn, D., and Israel, M. A. (1988) J. Biol. Chem. 263, 11559-11563 [Abstract/Free Full Text]
  59. Iacangelo, A., Fischer-Colbrie, R., Koller, K. J., Brownstein, M. J., and Eiden, L. E. (1988) Endocrinology 122, 2339-2341 [Abstract/Free Full Text]
  60. Wu, H.-J., Rozansky, D. J., Parmer, R. J., Gill, B. M., and O'Connor, D. T. (1991) J. Biol. Chem. 266, 13130-13134 [Abstract/Free Full Text]
  61. Iacangelo, A., Okayama, H., and Eiden, L. E. (1988) FEBS Lett. 227, 115-121 [CrossRef][Medline] [Order article via Infotrieve]
  62. Lazure, C., Paquet, L., Litthauer, D., Naude, R. J., Oelofsen, W., and Chretien, M. (1990) Peptides 11, 79-87 [CrossRef][Medline] [Order article via Infotrieve]
  63. Corti, A., Longhi, R., Gasparri, A., Chen, F., Pelagi, M., and Siccardi, A. G. (1996) Eur. J. Biochem. 235, 275-280 [Medline] [Order article via Infotrieve]

©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Sci SignalHome page
C.-u. Choe and B. E. Ehrlich
The Inositol 1,4,5-Trisphosphate Receptor (IP3R) and Its Regulators: Sometimes Good and Sometimes Bad Teamwork
Sci. Signal., November 28, 2006; 2006(363): re15 - re15.
[Abstract] [Full Text] [PDF]


Home page
EndocrinologyHome page
J. R. Peinado, R. Vazquez-Martinez, D. Cruz-Garcia, A. Ruiz-Navarro, Y. Anouar, M. C. Tonon, H. Vaudry, F. Gracia-Navarro, J. P. Castano, and M. M. Malagon
Differential Expression and Processing of Chromogranin A and Secretogranin II in Relation to the Secretory Status of Endocrine Cells
Endocrinology, March 1, 2006; 147(3): 1408 - 1418.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C.-U. Choe, K. D. Harrison, W. Grant, and B. E. Ehrlich
Functional Coupling of Chromogranin with the Inositol 1,4,5-Trisphosphate Receptor Shapes Calcium Signaling
J. Biol. Chem., August 20, 2004; 279(34): 35551 - 35556.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. C. Thrower, C. U. Choe, S. H. So, S. H. Jeon, B. E. Ehrlich, and S. H. Yoo
A Functional Interaction between Chromogranin B and the Inositol 1,4,5-Trisphosphate Receptor/Ca2+ Channel
J. Biol. Chem., December 12, 2003; 278(50): 49699 - 49706.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. C. Thrower, H. Y. Park, S. H. So, S. H. Yoo, and B. E. Ehrlich
Activation of the Inositol 1,4,5-Trisphosphate Receptor by the Calcium Storage Protein Chromogranin A
J. Biol. Chem., May 3, 2002; 277(18): 15801 - 15806.
[Abstract] [Full Text] [PDF]


Home page
J. Histochem. Cytochem.Home page
G. M. Portela–Gomes and M. Stridsberg
Selective Processing of Chromogranin A in the Different Islet Cells in Human Pancreas
J. Histochem. Cytochem., April 1, 2001; 49(4): 483 - 490.
[Abstract] [Full Text]


Home page
J. Biol. Chem.Home page
K. Lugardon, R. Raffner, Y. Goumon, A. Corti, A. Delmas, P. Bulet, D. Aunis, and M.-H. Metz-Boutigue
Antibacterial and Antifungal Activities of Vasostatin-1, the N-terminal Fragment of Chromogranin A
J. Biol. Chem., April 6, 2000; 275(15): 10745 - 10753.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Gadroy, M. Stridsberg, C. Capon, J.-C. Michalski, J.-M. Strub, A. Van Dorsselaer, D. Aunis, and M.-H. Metz-Boutigue
Phosphorylation and O-Glycosylation Sites of Human Chromogranin A (CGA79-439) from Urine of Patients with Carcinoid Tumors
J. Biol. Chem., December 18, 1998; 273(51): 34087 - 34097.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Strub, J.-M.
Right arrow Articles by Metz-Boutigue, M.-H.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Strub, J.-M.
Right arrow Articles by Metz-Boutigue, M.-H.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1997 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement