Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Arendt, C. W.
Right arrow Articles by Ostergaard, H. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Arendt, C. W.
Right arrow Articles by Ostergaard, H. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


Volume 272, Number 20, Issue of May 16, 1997 pp. 13117-13125
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Identification of the CD45-associated 116-kDa and 80-kDa Proteins as the alpha - and beta -Subunits of alpha -Glucosidase II*

(Received for publication, February 13, 1997, and in revised form, March 17, 1997)

Christopher W. Arendt Dagger and Hanne L. Ostergaard §

From the Department of Medical Microbiology and Immunology, University of Alberta, Edmonton, Alberta T6G 2H7, Canada

ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES


ABSTRACT

CD45 is an abundant, highly glycosylated transmembrane protein-tyrosine phosphatase expressed on hematopoietic cells. Herein we demonstrate that two proteins of 116 kDa and 80 kDa copurify with CD45 from mouse T cells. Microsequence analysis of the 116-kDa protein revealed high similarity to an incomplete human open reading frame that has been suggested to correspond to the catalytic alpha -subunit of glucosidase II. We determined the nucleotide sequence of the mouse cDNA and observed that it encodes a protein product nearly identical to its human homologue and shares an active site consensus sequence with Family 31 glucosidases. Amino acid sequencing of the 80-kDa protein, followed by molecular cloning, revealed high homology to human and bovine cDNAs postulated to encode the beta -subunit of glucosidase II. Antisera developed to the mouse beta -subunit allowed us to demonstrate that the interaction between CD45 and glucosidase II can be reconstituted in vitro in an endoglycosidase H-sensitive manner. The strong interaction between glucosidase II and CD45 may provide a paradigm for investigating novel aspects of the biology of these proteins.


INTRODUCTION

CD45 is a high molecular mass (~180-~220 kDa) transmembrane protein-tyrosine phosphatase (PTP)1 expressed in abundance on all cells of hematopoietic lineage (1). Although CD45 is encoded by a single gene, alternative splicing of the mRNA allows for the generation of at least eight distinct isoforms of the molecule based on variable usage of exons 4-6, which encode a region of the amino-terminal ectodomain. Of particular interest, and experimental utility, is the observation that these isoforms are expressed in a cell type-specific and differentiation stage-specific manner. The variable exon repertoire expressed by different isoforms is known to greatly influence the charge properties of CD45 since the region encoded by these exons contains multiple sites for O-linked glycosylation (2). CD45 also possesses 11-18 putative N-linked glycosylation sites, which are subject to cell-specific controls, conferring further microheterogeneity upon CD45 (3). It has been estimated that approximately one third of the total molecular weight of mature CD45 is contributed by carbohydrates, which vary qualitatively and quantitatively depending on the particular cell and isoform(s) expressed (3).

The cytoplasmic domain of CD45 is identical among all isoforms and encodes two tandem PTP domains, at least one of which possesses intrinsic activity (1). A series of studies in CD45-deficient cell lines (1) and, more recently, in CD45 gene-disrupted mice (4, 5) have revealed that CD45 functions as a key regulator of maturation and activation pathways in lymphocytes. One mechanism through which CD45 appears to function is by regulating the activity of various members of the Src family of protein-tyrosine kinases (1). Despite the advances that have been made, questions remain regarding many aspects of the biology of CD45. For example, it is not known whether certain, as yet unidentified, factors are responsible for regulating the PTP activity of CD45, possibly by directing the subcellular localization of the phosphatase. It is also not clear whether, in addition to its ability to regulate Src family kinases, CD45 performs additional functions in hematopoietic cells distinct from, and possibly more general than, its ability to regulate cellular activation pathways.

One means through which insight can potentially be gained into the regulation and function of CD45 is to identify molecules with which it physically interacts. Previously, we described a 116-kDa glycoprotein of unknown identity that specifically associates with CD45 in a wide variety of hematopoietic cells (6). We have now employed affinity chromatography to purify this protein along with an additional CD45-associated protein of 80 kDa. Amino acid microsequence analysis of these proteins, followed by molecular cloning, has revealed that they are the mouse homologues of two proteins that copurify with glucosidase II activity from rat liver microsomes (7). The characterization of the association of these molecules with CD45 may provide insight into novel aspects of the biology of this complex glycoprotein.


EXPERIMENTAL PROCEDURES

Cell Lines and Monoclonal Antibodies

The mouse T-lymphoma cell lines SAKRTLS 12.1 (SAKR) and BW5147 (BW), CD45-negative variants of these lines (SAKR/CD45- and BW/CD45-), and a revertant of BW/CD45- expressing a truncated form of CD45 (BW/rev) (8) were obtained from Dr. R. Hyman (The Salk Institute, La Jolla, CA) and maintained as described previously (6). Monoclonal antibodies I3/2.3 (9) and M1/9.32 HL2 (American Type Culture Collection), recognizing pan-specific determinants in the CD45 ectodomain, and monoclonal antibody M1/42.3.9.8 (ATCC), directed against class I major histocompatibility complex (MHC) molecules, were purified and directly coupled to cyanogen-activated Sepharose 4B (6).

Preparation of Cell Lysates and Immunoprecipitates

Post-nuclear extracts from 5 × 107 cells resuspended in ice-cold lysis buffer (0.5% Nonidet P-40, 150 mM NaCl, 10 mM Tris, pH 7.6) were prepared as described (6) and incubated either for 1-2 h with antibody-coupled Sepharose 4B beads that had previously been blocked with 4% bovine serum albumin or for 30-60 min with 5 µl of polyclonal antiserum. Rabbit antiserum was subsequently absorbed to Protein A-Sepharose beads (Pharmacia Biotech Inc.) for 1-2 h. Immunoprecipitates were washed three to five times in high salt wash buffer (lysis buffer containing 0.5 M NaCl) followed by one or two washes in lysis buffer. Proteins were released by boiling in reducing sample buffer and subjected to electrophoretic analysis.

Polyacrylamide Gel Electrophoresis, Protein Staining, and Immunoblotting

Proteins were resolved on 7.5% gels by the Laemmli method (10) and either stained directly with Coomassie Blue R-250 or transferred to Immobilon-P (Millipore) as described (6). Transferred proteins were stained with India Ink or subjected to Western blot analysis using the indicated antisera followed by Protein A-HRP (Pierce) and detected by enhanced chemiluminescence detection reagents (DuPont NEN). Apparent molecular weights of the CD45-associated proteins were estimated by comparison to the mobilities of known standard proteins (Bio-Rad).

Purification of CD45-associated Proteins

Post-nuclear extracts from 1-2 × 1010 viable SAKR or SAKR/CD45- cells were prepared as described above, passed through 0.45-µm filters (Costar), and applied overnight to an affinity column containing a 10-ml bed volume of Sepharose-I3/2 or -M1/42. The column was washed with 200-300 ml of high salt (0.5 M NaCl) wash buffer followed by approximately 150 ml of lysis buffer. Elution buffer (0.5% DOC, 20 mM Tris, pH 7.6) was applied, and 1-ml fractions were collected, saving 40 µl from each for electrophoretic analysis.

Microsequence Analysis

The I3/2 immunoaffinity column fractions positive for 80-kDa and 116-kDa CD45-associated proteins were pooled and concentrated using Mr 30,000 cut-off Ultrafree-MC Filters (Millipore), separated on preparative gels, transferred to Immobilon-P, and stained. Protein bands were excised for amino-terminal sequence analysis or digested with 30 mg/ml cyanogen bromide in 70% formic acid prior to solid phase microsequence analysis by the Alberta Peptide Institute (Edmonton, AB, Canada).

Cloning of Glucosidase II alpha -Subunit

Based on microsequence analysis of the p116 protein, degenerate oligonucleotides were synthesized. These were screened for their ability to amplify DNA from random-primed, reverse-transcribed SAKR poly(A)+ RNA. Two primers, 5'-tt(ct)ga(ag)ca(ct)ca(ag)(ac)g(ag)gc-3' (a sense oligonucleotide corresponding to internal peptide sequence FEHQRA), and 5'-at(agct)gg(ag)tc(ag)tc(ct)ttcat-3' (an antisense oligonucleotide corresponding to internal peptide sequence MKDDPI), were found to amplify a 1.9-kb fragment. The PCR amplicon was cloned into the pCRII vector (Invitrogen), and partial sequencing confirmed the presence of nucleotide sequence in agreement with our amino acid microsequence data. The insert was excised, labeled, and used to screen a Uni-ZAP XR oligo(d)T-primed mouse EL4 T-cell cDNA expression library (Stratagene). The longest clone was found to be incomplete after sequencing. To isolate the 5' end of the cDNA, two sequential rounds of PCR-RACE were performed with the Marathon cDNA Amplification kit (CLONTECH) using SAKR cDNA as a template. The specific antisense PCR primers were designed to span nucleotides 1586-1609 (first round) and 231-260 (second round) and were used in conjunction with the adapter primer (AP1) supplied with the kit. Products of approximately 1.6 kb (first round) and 0.3 kb (second round) were TA cloned directly from the reaction mix. Positive clones containing sequences overlapping those of the incomplete cDNA were fully sequenced in both directions. Finally, the entire open reading frame of p116 was PCR-amplified using a primer pair spanning nucleotides 1-26 and 3065-3091, cloned into pCRII, and sequenced.

Cloning of Glucosidase II beta -Subunit

The entire open reading frame of human homologue 80K-H (11) was cloned by RT-PCR from the A431 human epidermal carcinoma cell line using primers spanning nucleotides 129-149 and 1718-1739. This amplicon was radiolabeled and used to screen the EL4 cDNA library as described above. Five positive clones were rescued, each with inserts of different sizes corresponding to the 3' end of mouse glucosidase II beta -subunit (GIIbeta ) mRNA, as revealed by partial sequencing. The longest of these, clone 80-5 (1.75 kb), was completely sequenced in both directions. The remaining 0.6-kb 5' end of the cDNA was cloned by PCR-RACE as outlined above, using a gene-specific primer spanning bases 603-636. The entire open reading frame was sequenced following RT-PCR amplification from SAKR cDNA using the primer pair 70-97 and 1681-1707.

Polyclonal Antisera

A fragment corresponding to amino acid residues 126-272 of GIIbeta was amplified by RT-PCR and cloned into the pGEX-4T-3 expression vector (Pharmacia). Recombinant GST-fusion protein from lysates of isopropyl-1-thio-beta -D-galactopyranoside-induced cultures (Boehringer Mannheim) was recovered using glutathione Sepharose-4B matrix (Pharmacia). Following extensive dialysis against phosphate-buffered saline, the fusion protein was injected into a rabbit via intramuscular and subcutaneous routes. The antiserum thus obtained was designated anti-80.1. The same strategy was employed to generate a second antiserum, designated anti-80.2, against a GST-fusion protein spanning COOH-terminal amino acid residues 444-521 of GIIbeta . In both cases, Coomassie Blue staining of the injected material confirmed that it was highly pure.

Reconstitution of Association with CD45

I3/2 immunoprecipitates were prepared from SAKR cells. Beads were washed twice with elution buffer (to remove CD45-associated proteins) and twice with lysis buffer, and then incubated for 1-2 h with 1 ml of detergent-solubilized extract from 5 × 107 SAKR/CD45- cells. Immune complexes were washed and processed for SDS-PAGE.

Endoglycosidase Treatment

CD45 was immunoprecipitated from SAKR cells and stripped of associated proteins as described for the reconstitution assays. CD45 beads were incubated for 16 h on a rotator at 37 °C in a 60-µl reaction mix containing 0.5 units of endoglycosidase F (Boehringer Mannheim) in 20 mM EDTA, 0.2 M sodium acetate, pH 6.0, or 10 milliunits of endo-beta -N-acetylglucosaminidase H (Boehringer Mannheim) in 0.2 M sodium acetate, pH 6.0. As a control, mock-treated samples were incubated in an equivalent volume of 20 mM EDTA, 0.2 M sodium acetate, pH 6.0. Digests were washed twice in high salt wash buffer and twice in regular lysis buffer. Reconstitution assays were then performed as outlined above.


RESULTS

Purification of CD45-associated Proteins

In our initial experiments to identify proteins that physically interact with CD45, we observed a protein with an apparent molecular mass of 116 kDa (p116) that was present in immunoprecipitates from CD45-positive T cells but absent from parallel immunoprecipitates from CD45-negative variants of these cells (6). Also visible on some of our gels, although frequently obscured by nonspecific protein bands, was a protein with an apparent mass of approximately 80 kDa (p80, Fig. 1). Association of these proteins with CD45 was stable in 0.5% Nonidet P-40 but not in 0.5% deoxycholate (DOC) (Fig. 1). Having failed to identify these proteins using antibodies to known molecules, we purified p116 and p80 by exploiting the differential detergent stability of the association. SAKR mouse T-lymphoma cells (>1010) were lysed in buffer containing 0.5% Nonidet P-40 and passed through an immunoaffinity column containing the same pan-specific anti-CD45 antibody (I3/2) employed in our immunoprecipitation assays. After extensive washing in high salt (0.5 M NaCl) buffer, fractions were eluted in 0.5% DOC. SDS-PAGE analysis of these fractions by total protein staining revealed two major components migrating at 116 and 80 kDa and additional minor species (Fig. 2A). To control for nonspecific protein associations, lysates from an equivalent number of cells from a CD45-negative variant of SAKR were processed in an identical manner. Analysis of column eluates from this experiment revealed only faintly staining minor species, indicating that the 80-kDa and 116-kDa proteins are physically complexed with CD45 (Fig. 2B). As a further control, we confirmed that p80 and p116 could not be copurified using an isotype-matched anti-class I MHC molecule (M1/42) immunoaffinity column (Fig. 2C). Thus, using an affinity chromatography strategy, we succeeded in copurifying two proteins of unknown identity by virtue of their stable association with CD45.


Fig. 1. CD45 association with p116 and p80 is stable in Nonidet P-40 but not deoxycholate. I3/2 (anti-CD45) immunoprecipitates prepared from 0.5% Nonidet P-40 (NP-40) lysates of CD45-positive (+) and CD45-negative (-) SAKR cells were washed in 0.5% Nonidet P-40 or 0.5% DOC. Proteins were separated by SDS-PAGE, transferred to Immobilon-P, and visualized by India Ink staining. Side arrows indicate the positions of 116-kDa and 80-kDa CD45-associated proteins.
[View Larger Version of this Image (52K GIF file)]


Fig. 2. Immunoaffinity purification of CD45-associated proteins. Nonidet P-40 lysates from 1.6 × 1010 CD45+ (A and C) or CD45- (B) SAKR cells were loaded onto I3/2 (A and B) or M1/42 (C) immunoaffinity columns. After washing in buffer containing 0.5 M NaCl, proteins were eluted by addition of buffered 0.5% DOC. Shown are Coomassie Blue-stained gels containing 40 µl from each 1-ml column fraction. Arrows designate the locations of p116 and p80.
[View Larger Version of this Image (52K GIF file)]

Microsequence Analysis and cDNA Cloning of p116 Identifies It as the Putative Catalytic Subunit of Glucosidase II

Having purified p116 and p80, we next subjected these proteins to amino-terminal microsequence analysis and utilized this sequence information to search the BLAST data base (12). Sequences from independently prepared samples of p116 revealed high homology to an incomplete human open reading frame (ORF), GenBank accession number D42041[GenBank], that had been randomly isolated from the immature myeloid cell line KG1 (Table I, samples 1 and 2). This ORF predicts a putative signal sequence upstream of our amino-terminal sequence but is lacking an ATG start codon. Seeking further evidence that p116 is the mouse homologue of this molecule, we obtained internal amino acid sequence information from peptide fragments generated by cyanogen bromide digestion. This internal sequence data closely matched the protein sequence predicted by the human ORF (Table I, samples 3-7) with the exception of one peptide fragment (sample 4) that could only be partially aligned with the human protein. Intriguingly, the D42041[GenBank] ORF recently has had a function ascribed it as the catalytic (alpha ) subunit of glucosidase II (GIIalpha ), an alpha -1,3 ER lumenal glucosidase, based on extensive microsequence analysis of a 110-kDa rat protein with glucosidase activity and deletion of a homologous gene in Saccharomyces cerevisiae (7).

Table I. Amino acid microsequence analysis of 116-kDa CD45-associated protein


No.a Mouse protein sequenceb Human D42041[GenBank] sequencec

1 vDRSNFKTxDESsFxkRQ VDRSNFKTCEESSFCKRQ (32-49)
2 vDRSNFKT VDRSNFKT (32-39)
3 vDrsnFktxdeS VDRSNFKTCEES (32-43)
4 MAFEHQRAPRVPFxDKVVLaLGSVd LEFEHQRAPRVSQGSKDPAEGDGA (175-198)
5 Mgagkpaavvl IGAGKPAAVVL (894-904)
6 MkddpitlfvalspqgT MKDDPITLFVALSPQGT (822-838)
7 Mkxdxitlfval MKDDPITLFVAL (822-833)

a Samples 1 and 2 were subjected to NH2-terminal sequence analysis. Samples 3-7 are peptide fragments generated by cyanogen bromide digestion. Peptide 3 corresponds to the NH2 terminus of the 116-kDa protein.
b Sequences are denoted in standard single-letter code. Some sequencing cycles yielded multiple peaks; in these cases the major peak is indicated in lowercase type. An "x" has been placed at positions where amino acid identity could not be determined. The identity of the methionine at the first position of peptides 4-7 is inferred.
c Regions of the human D42021[GenBank] ORF (GenBank) homologous to those sequenced in the 116-kDa mouse protein are presented. The location of these residues in the human protein is indicated in parentheses. Boldface type identifies human sequences that do not match those in the mouse protein.
d Residue underlined is the only site that does match the protein sequence predicted by the cDNA clone of the 116-kDa mouse protein, presented in Fig. 3.

Given that a full-length cDNA for GIIalpha had not been isolated in mammalian cells, and to confirm the identity of p116 as the mouse homologue of this molecule, we sought to clone and sequence the corresponding cDNA from mouse T cells. Several degenerate oligonucleotide primers were synthesized based on our peptide sequence data. Two of these amplified a 1.9-kb RT-PCR fragment from SAKR cDNA. Cloning and partial sequencing of this amplicon revealed high homology to D42041[GenBank]. Probing of an oligo(dT)-primed mouse T-cell cDNA library with this PCR product led to the isolation of two clones, each 2.9 kb in size, which appeared, from restriction analysis, to be derived from the same mRNA. One of these was sequenced in entirety and found to encode an ORF highly homologous to human D42021[GenBank], containing a stop codon and downstream polyadenylation signal, but lacking over 1 kb of 5' sequence. Two rounds of PCR-RACE led to the isolation of a cDNA fragment that contained 11 bases in the 5'-untranslated region. Juxtaposing the first ATG triplet is a motif that conforms well with the consensus sequence for initiation of translation in vertebrates (13). The predicted mass of the nascent product encoded by the longest ORF (109 kDa) and the fact that our amino acid sequence information matches that predicted by the nucleotide sequence at all but a single residue (Table I) strongly argue that the cDNA sequence we obtained corresponds to that of the p116 protein that we co-purified with CD45.

Shown in Fig. 3 in alignment with human ORF D42041[GenBank], the product of the cDNA contains a long, hydrophobic leader peptide that appears to be cleaved at Ala-32, based on our amino-terminal sequence data and amino-terminal sequence analysis of the rat homologue (7). An additional 22 amino acids is predicted in the mouse protein (positions 187-208), explaining why our amino acid sequence of this region (Table I) only partially matched the sequence of the human protein. Consistent with our previous biochemical analysis of p116 suggesting limited N-linked glycosylation (6) and analysis by others of an apparently identical protein possessing N-glycans of the high mannose type (7, 14-17), a single N-linked glycosylation consensus sequence is present in the mouse protein. Notable also is a conspicuous 21-amino acid hydrophobic stretch (Fig. 3, underlined), which, based on biochemical data from a number of sources, does not appear to function as a transmembrane domain (7, 17, 18). Given that the protein product of our mouse cDNA shares 90% identity with human ORF D42041[GenBank], which has recently been shown to have glucosidase II catalytic function (7), we conclude that the cDNA we have cloned encodes the alpha -subunit of mouse glucosidase II, a protein that stably associates with CD45 in T cells.


Fig. 3. Amino acid sequence alignment of mouse GIIalpha with its human homologue and a Family 31 glycosyl hydrolase. The deduced amino acid sequence of mouse GIIalpha is compared with the predicted sequence of human homologue D42041[GenBank]. Also aligned with these sequences is a portion (amino acids 478-776) of H-LAG. Dots identify residues identical with the mouse sequence; gaps are signified by hyphens. An arrow marks the amino terminus of the mature protein, and a hydrophobic stretch of amino acids is underlined. An arrowhead denotes the position of the single Asn-linked glycosylation consensus sequence. The region corresponding to the active site in H-LAG is presented in boldface type, and an asterisk indicates the catalytic nucleophile.
[View Larger Version of this Image (67K GIF file)]

Glucosidase II alpha -Subunit Possesses Regions of Homology to Family 31 Glucosidases

That the large subunit of glucosidase II, alone, accounts for the catalytic activity of the molecule is suggested by a number of studies (7, 16-18). Data base analysis of mouse and human GIIalpha protein sequences revealed regions of considerable homology to Family 31 glycosyl hydrolases. Contained within this family are a number of ancestrally related gene products, including the intestinal sucrase-isomaltase complex and lysosomal alpha -glucosidase (19, 20). Shown in Fig. 3 is a portion of the carboxyl-terminal sequence of human lysosomal alpha -glucosidase (H-LAG) (21) aligned with mouse and human GIIalpha . A significant degree of homology exists between the aligned regions of these molecules, with 36% sequence identity between H-LAG and mouse GIIalpha . In contrast to this, the remaining amino- and carboxyl-terminal portions of H-LAG (amino acids 1-477 and 777-952, respectively) cannot be aligned with GIIalpha sequences. Of particular interest is the conservation of a number of residues in the region surrounding Asp-518 in H-LAG (Fig. 3, residues 514-521). Asp-518 has been identified by mutagenesis as the catalytic nucleophile of H-LAG, while Trp-516 has also been shown to be essential for catalytic function (22). These residues, together with flanking sequences, define the catalytic consensus sequence for Family 31 glycosyl hydrolases: (G/F)-(L/I/V/M)-W-X-D-M-N-E (19, 21-26). As can been seen from the alignments in Fig. 3, human GIIalpha possesses the entire catalytic consensus sequence of acid alpha -glucosidase, while the mouse sequence predicts a conservative substitution of Tyr for Phe at position 560. Although all of these enzymes are alpha -glucosidases, their specific activities are distinct. Lysosomal alpha -glucosidase is an acid hydrolyze that functions to cleave alpha -1,4 and alpha -1,6 linkages in glycogen, maltose, and isomaltose (27, 28), while glucosidase II has been shown to act upon alpha -1,3 glucosidic linkages present on immature ER glycoproteins, although it also possesses alpha -1,4 activity (29). Moreover, the pH optima of these enzymes appear to be mutually exclusive (15, 28). Of note, Family 31 sucrase and isomaltase possess substrate specificities and catalytic consensus sequences similar to those of lysosomal alpha -glucosidase (21, 23), but exhibit neutral pH optima (30). Taken together, these observations imply that the conserved catalytic consensus sequence in GIIalpha , shared among a number of apparently ancestrally related genes encoding functionally divergent alpha -glucosidases, represents the active site of the molecule, while other non-conserved regions may direct the specificity of the enzyme.

Identification and cDNA Cloning of the 80-kDa CD45-associated Protein Corresponding to the Putative beta -Subunit of Glucosidase II

Microsequence information derived from the amino terminus of purified p80, in addition to limited sequence data from an internal cyanogen bromide-digested peptide fragment (Table II), revealed a close relationship to a human cDNA that was originally cloned as a potential PKC substrate, termed 80K-H (11). More recently, this protein has been proposed to function as a second (beta ) subunit of glucosidase II (GIIbeta ), based primarily on the observation that it copurifies with the alpha -subunit from rat microsomes and is resistant to biochemical separation from this larger subunit (7). The high degree of amino acid conservation between the amino termini of mouse p80 and human 80K-H (Table II) led us to attempt to isolate the mouse cDNA by cross-species hybridization. A RT-PCR amplicon corresponding to the entire coding region of human 80K-H was used to screen a mouse T-cell cDNA library for homologous sequences. Five independent clones were rescued from the library, and their inserts were completely or partially sequenced. All appeared to encode an identical protein exhibiting high homology to 80K-H, although all were missing varying amounts of 5' sequence. PCR-RACE was employed to isolate the 5' end of the cDNA, and PCR cloning of the entire ORF was carried out in SAKR cells.

Table II. Amino acid microsequence analysis of 80-kDa CD45-associated protein


No.a Mouse protein sequenceb Human 80K-H sequencec

1 VeVKRPrGVsl VEVKRPRGVSL (15-25)
2 vEvKRP VEVKRP (15-20)
3 VEVKRPxGVSLSNHHFYEESKPFTcLDGTATIPFD VEVKRPRGVSLTNHHFYDESKPFTCLDGSATIPFD (15-49)
4 MkYEQ MKYEQ (462-466)

a Sample 1 was subjected to NH2-terminal sequence analysis. Samples 2-4 are cyanogen bromide-cleaved peptide fragments, with peptides 2 and 3 representing the NH2 terminus of the 80-kDa protein.
b Sequences are presented as outlined in the footnote to Table I. The identity of the methionine at the first position of peptide 4 is inferred.
c Regions of the human 80K-H protein homologous to those sequenced in the 80-kDa mouse protein are presented as described in the footnote to Table I.

The protein sequence deduced from our cloning experiments is presented in Fig. 4. Significantly, the mouse cDNA product possesses sequences identical to those obtained from microsequence analysis of p80 (Table II). Data base analysis of the complete coding region revealed striking homology to the human 80K-H protein and an unpublished bovine sequence (GenBank accession number U49178[GenBank]), also shown in Fig. 4, but no additional significant primary sequence homologies to other known proteins. The mouse cDNA encodes a highly acidic 59-kDa nascent protein, which lacks a transmembrane domain but possesses a hydrophobic signal sequence that, based upon amino-terminal sequencing of the mature protein, is cleaved at position 14 in mouse (Table II) and at the corresponding site in other species (7, 11, 31, 32). The mouse protein shares 86% amino acid identity with its human homologue and 82% identity with the bovine product, with conservation of a number of motifs of potential functional significance. Shared by all species is a carboxyl-terminal His-Asp-Glu-Leu (HDEL) sequence, which may serve as an ER-retention/retrieval signal by virtue of its ability to interact with a specialized membrane receptor (33-35). A region containing tandem glutamic acid repeats is also present in all species; such negatively charged domains are common among ER proteins and may function to allow these proteins to coordinate Ca2+, possibly as an additional ER retention mechanism (36-38). The unusual charge properties of this region may contribute to the anomalously slow migration of this molecule by SDS-PAGE, as has been observed for similar proteins (11). In addition to the possible Ca2+ binding activity of the acidic stretch, two putative EF-hand motifs are present, which may confer high affinity Ca2+ binding capacity (39). Finally, it is noteworthy that the distribution of cysteine residues, clustered near the amino- and carboxyl termini of the molecule, is entirely conserved between species, in agreement with evidence for the presence of intrachain disulfide linkages in the rat homologue (7). In summary, the second cDNA we have cloned encodes a product that is highly conserved on an evolutionary basis and possesses several hallmarks of an ER protein. Our ability to copurify this molecule with the catalytic subunit of glucosidase II and the major glycoprotein CD45 is in agreement with a study in the rat system proposing that it represents the strongly associated beta -subunit of mouse glucosidase II, which may function, in part, to retain the catalytic subunit in proximity to the membrane of the endoplasmic reticulum (7).


Fig. 4. Comparison of mouse, human, and bovine proteins encoding the putative beta -subunit of glucosidase II. Predicted amino acid sequence of the 80-kDa mouse protein is shown together with homologous human and bovine (U49178[GenBank]) open reading frames. Human and bovine sequences matching those in mouse are indicated with dots; gaps (-) are marked. An arrow identifies the amino terminus of the processed protein. Two putative EF-hand domains are underlined, and a highly acidic stretch is presented in boldface type. The carboxyl-terminal HDEL tetrapeptide is italicized. Cysteine residues, all of which are conserved among the three species, are noted with asterisks.
[View Larger Version of this Image (55K GIF file)]

The Association between CD45 and Glucosidase II Can Be Reconstituted in Vitro

Antisera to two distinct regions of GIIbeta were generated by injecting recombinantly expressed GST-fusion proteins into rabbits. Both sera (anti-80.1 and anti-80.2), but not preimmune sera from these rabbits, were capable of blotting and immunoprecipitating the 80-kDa protein from SAKR cells or I3/2 column fractions (Fig. 5A and data not shown). In addition, GIIbeta immunoprecipitated with one antibody could be immunoblotted with the other antibody, and vice versa (data not shown). As an additional control, we confirmed that immunoreactive protein is absent from immunoprecipitates prepared using M1/42 antibody (Fig. 5B). A second antibody to CD45 that is known to co-precipitate the 116-kDa (alpha -subunit) protein (6) was also found to co-precipitate GIIbeta (Fig. 5B). These results convincingly argue that the cDNA clone we obtained representing GIIbeta encodes the same molecule that we had purified by virtue of its ability to form a stable complex with the alpha -subunit and CD45.


Fig. 5. Reactivity of specific antisera generated against recombinant GIIbeta . Polyclonal antisera (anti-80.1 and anti-80.2) were generated to two non-overlapping portions of mouse glucosidase IIbeta expressed as recombinant GST-fusion proteins. A, extracts from CD45+ (+) and CD45- (-) cells were subjected to immunoprecipitation using the anti-80 sera or preimmune sera from the same rabbits. The Western blot shown was probed with anti-80.1 serum. The side arrow marks the position of GIIbeta . B, immunoprecipitates were prepared from CD45+ and CD45- SAKR cells using the antibodies indicated. Anti-80.1 serum was employed in Western blot analysis.
[View Larger Version of this Image (44K GIF file)]

We previously reported that the interaction between CD45 and the 116-kDa (alpha -subunit) protein could be reconstituted in vitro by mixing affinity purified CD45 that had been stripped of associated molecules with lysates from CD45-negative cells (6). Since the 80-kDa region of these protein-stained gels was obscured by nonspecific bands, we repeated these experiments and assayed for in vitro association of the beta -subunit with CD45 using our specific antisera. As anticipated, we found that washing CD45 immunoprecipitates with 0.5% DOC led to release of the 80-kDa associated protein (Fig. 6, lane 3). By incubating CD45-positive immune complexes that had been washed with DOC with lysates from SAKR/CD45- cells, we were able to reconstitute the association between CD45 and GIIbeta (Fig. 6, lane 4). The association could not be reconstituted if CD45-negative beads were incubated with the cell lysates (Fig. 6, lane 5). In conjunction with our previous analysis of the 116-kDa protein, and consistent with the success of our purification strategy (Fig. 2A), these data indicate that the interaction between CD45 and glucosidase II is stable and of high affinity.


Fig. 6. In vitro reconstitution of the association between CD45 and GIIbeta . I3/2 immunoprecipitates were prepared from CD45+ (1) and CD45- (2) SAKR cells. Parallel I3/2 immunoprecipitates from CD45+ (3 and 4) or CD45- (5) cells were washed with 0.5% DOC to release CD45-associated proteins and re-incubated with lysis buffer (3) or with lysates from CD45- cells (4 and 5). Proteins were resolved by SDS-PAGE, and GIIbeta was detected with anti-80.1 serum.
[View Larger Version of this Image (27K GIF file)]

Binding of Glucosidase II to CD45 Is Dependent upon Endoglycosidase H-sensitive Oligosaccharide Linkages

The apparent strength and high stoichiometry of association between glucosidase II and CD45, and the resistance of this association to disruption in 0.5 M NaCl, were surprising. Although CD45 is an abundant and highly glycosylated protein in T cells, we failed to copurify with it detectable levels of any other carbohydrate-processing enzymes or ER chaperone molecules (Fig. 2A). Moreover, we failed to copurify glucosidase II with another cell-surface glycoprotein, the class I MHC molecule (Fig. 2C). We thus sought to investigate the structural requirements mediating the association of these proteins. To first eliminate the possibility that the CD45 cytoplasmic domain, which is not exposed to the ER lumen, is required for these proteins to associate, we confirmed that the association between GIIbeta and CD45 can occur in a revertant of a CD45-negative cell (8) that expresses reduced levels of a truncated form of CD45 lacking most of the cytoplasmic domain (Fig. 7A). This result is in accordance with our previous observation that the 116-kDa alpha -subunit also associates with this mutant form of CD45 (6). We next asked whether immature N-linked oligosaccharides of the high mannose, Endo H-sensitive type are necessary for the interaction of these proteins. We incubated CD45 that had been washed with DOC to strip it of associated proteins with either Endo H, which releases high mannose type linkages, Endo F, which releases all N-linkages, or digestion buffer alone. We then assayed for the ability of GIIbeta from CD45-negative lysates to become associated with deglycosylated CD45. As is clear from the data presented in Fig. 7B, our ability to reconstitute the association between GIIbeta and CD45 was dependent upon the presence of N-linked carbohydrates, specifically those of the high mannose, Endo H-sensitive type. This result indicates that immature triantennary carbohydrate structures present on CD45 are necessary for the association with glucosidase II; based on the known specificity of glucosidase II, we speculate that terminal alpha -1,3 glucose linkages are specifically required. We cannot, however, formally exclude the possibility that other binding determinants on CD45 may interact with GIIalpha and GIIbeta .


Fig. 7. Structural requirements for GIIbeta binding to the CD45 ectodomain. A, I3/2 immunoprecipitates prepared from BW, BW/CD45-, and BW/rev cell lysates were subjected to immunoblotting with anti-80.1 serum. B, CD45 was immunoprecipitated from SAKR lysates and stripped of associated proteins by DOC treatment. Immune complexes were then incubated with Endo F, Endo H, or buffer alone (Mock) for 16 h at 37 °C. The ability of de-glycosylated CD45 to associate with GIIbeta was assayed by incubating with SAKR/CD45- cell lysates. Bound GIIbeta was revealed by anti-80.1 serum in Western blot analysis.
[View Larger Version of this Image (11K GIF file)]


DISCUSSION

Glucosidase II is a neutral exo-glucohydrolase that localizes primarily to the ER and transitional elements (40, 41) and is involved in the processing of N-linked triantennary core glycans following their co-translational transfer to nascent polypeptide chains. Glucosidase II acts in sequence after glucosidase I has cleaved the terminal, alpha -1,2-linked glucose (Glc) from protein-conjugated Glc3(mannose)9(N-acetylglucosamine)2 to hydrolyze the inner two alpha -1,3-linked Glc units (42). The activity of glucosidase II in the ER is counteracted by that of a UDP-Glc:glycoprotein glucosyltransferase, which can add back a single Glc linkage to (mannose)9(N-acetylglucosamine)2 (7). The opposing activities of these two enzymes has been accounted for in a "quality-control" model of ER processing, whereby incompletely folded proteins must present a monoglucose moiety to be recognized by the folding chaperone calnexin (43-46). This scheme ascribes a dual function to glucosidase II. By removing the first alpha -1,3-linked Glc, glucosidase II allows nascent polypeptides to interact with calnexin, and by removing the innermost Glc, it regulates the dissociation of folded proteins from calnexin and allows for their egress from the ER.

The design of lengthy purification protocols allowed several groups to isolate glucosidase II and characterize its activity (15, 16, 18, 29, 47). However, the molecular identity of this enzyme was not revealed until recently, when Trombetta et al. reported the results of exhaustive microsequence analysis of two proteins that copurify as a heterooligomer with glucosidase II activity from rat liver microsomes (7). We now report the cloning of two homologous mouse cDNAs that encode proteins that copurify with the transmembrane PTP, CD45, in T cells.

The larger of these proteins (116 kDa in mouse, 110 kDa in rat) is a molecule that we partially characterized as a tyrosine-phosphorylated transmembrane glycoprotein that physically associates with CD45 in a wide variety of hematopoietic cell lines (6). Our present work reveals that the cDNA sequence encodes a nascent protein with a mass of 109 kDa that shares 90% sequence identity with the product of an uncharacterized human ORF (GenBank accession number D42041[GenBank]) that lacks an initiation codon and 5'-flanking sequences. An internal region near the carboxyl termini of these mouse and human proteins contains considerable sequence identity to Family 31 glycosyl hydrolases, including a highly conserved catalytic consensus sequence. This observation, combined with the finding that disruption of a gene homologous to our cDNA in S. cerevisiae resulted in the complete loss of glucosidase II activity (7), suggests that the protein encoded by this cDNA is the catalytic unit of glucosidase II (GIIalpha ). We have also been able to detect glucosidase II activity in CD45 and GIIbeta but not in class I MHC immunoprecipitates (data not shown); however, in the absence of an antibody to the catalytic subunit, it is difficult to determine if the activity that we observe is significant.

The mouse cDNA encoding the smaller protein that we copurified with CD45 and that was copurified with glucosidase II activity by Trombetta et al. (80 kDa in mouse, 90 kDa in rat) shares high sequence identity with a previously cloned human protein, termed 80K-H (11), and an unpublished bovine sequence (U49178[GenBank]). The human cDNA was originally isolated in an attempt to clone what appeared to be two major PKC substrates of 80 kDa, termed 80K-H (for "high") and 80K-L (for "low") based on their gel mobilities (48). The clone isolated as 80K-H, however, proved to be a poor substrate for this kinase (48), in contrast to the 80K-L protein, which was revealed to be the biochemically similar, but genetically distinct, myristylated alanine-rich protein kinase C substrate (48-50). More recently, the 80K-H protein was identified as one of several proteins in the 90-kDa molecular mass range to become tyrosine-phosphorylated in response to basic fibroblast growth factor (32). In conflict with these data implicating 80K-H in intracellular signal transduction cascades is information suggesting a role for this molecule as a cell-surface receptor or co-receptor on cells of the monocyte/macrophage lineage, conferring an ability to bind proteins modified by advanced glycation end products, a heterogeneous series of complex end-products resulting from the non-enzymatic reaction of free-amino groups of proteins with reducing sugars such as Glc (51). Added to this is the report from Trombetta et al. identifying 80K-H as the beta -subunit of glucosidase II, based on the finding that GIIalpha and GIIbeta exist as a heterooligomer and are refractory to biochemical separation (7).

Although it is not yet possible to completely resolve these diverse observations, a number of clues to the localization of this molecule emerge from analysis of its cDNA sequence. Highly revealing is the fact that 80K-H possesses a hydrophobic signal sequence that is cleaved at the same position in the mouse protein as in the human and rat proteins identified in the studies described above (7, 11, 31, 32). Since the mature protein lacks a transmembrane domain, this implies that the protein initially enters the secretory pathway. Also present in 80K-H, and conserved among mouse, human, and bovine, is a carboxyl-terminal HDEL tetrapeptide. This sequence has been shown to interact with a membrane receptor that functions to continually retrieve from the Golgi and return to the ER proteins containing specific carboxyl-terminal tetrapeptides (33). Moreover, mutation of the HDEL tetrapeptide found in ER proteins has been shown to favor the secretory pathway (34, 35). 80K-H has in common with other ER proteins a highly acidic region that may bind Ca2+ at low affinity, forming a "zipper" structure linking ER proteins in a loose matrix (36-38). 80K-H also possesses a pair of 12-amino acid motifs that may form two interacting helix-loop-helix EF-hand structures (39). Such motifs have been shown to coordinate Ca2+ in other ER proteins, and may allow for conformational regulation by Ca2+ levels or confer a buffering capacity on the protein (34, 35). Finally, 80K-H possesses a polar distribution of conserved Cys residues and possesses intrachain disulfide linkages (7). Taken together, these observations are consistent with 80K-H residing in the ER lumen.

Our biochemical data fit best with the suggestion by Trombetta et al. that 80K-H represents the beta -subunit of glucosidase II. We have shown that the 80-kDa protein co-purifies with GIIalpha and a major cellular glycoprotein. Moreover, we have found that the 80-kDa protein can associate with glucosidase II activity in the absence of detectable CD45 (data not shown). Although GIIbeta does not appear to be necessary for GIIalpha catalytic function (7, 16-18), it may be capable of modulating the activity of the holoenzyme. Additionally, it may function to retain the alpha -subunit in association with the lumenal face of the ER membrane. If correct, this could explain why an 80-90-kDa protein was consistently observed to be present in GIIalpha preparations after exhaustive purification steps (7, 16, 18) and also help reconcile the ability of GIIalpha to partition to the membrane fraction as a non-integral protein (6, 18). It is important to note, however, that GIIbeta (80K-H) has been purified in the apparent absence of the larger catalytic subunit (11, 31). Our data do not exclude the possibility that 80K-H may adhere to a cell-surface protein(s) in certain cell types, where it may contribute to the binding of proteins modified by advanced glycation end products. The basis for detecting an admittedly small subpopulation of tyrosine-phosphorylated 80K-H in a previous study, however, is unclear (32); we have been unable to detect tyrosine phosphorylation of this protein in response T-cell receptor-stimulation of CTL clone cells (data not shown).

An important question arising from our study is why are we able to copurify glucosidase II with CD45. Our evidence that the interaction between glucosidase II and CD45 is dependent on high mannose triantennary core oligosaccharide linkages supports the hypothesis that glucosidase II interacts with immature CD45 that presumably contains terminal alpha -1,3 Glc linkages. The simplest explanation for our results is that GIIalpha and GIIbeta interact with CD45 in the same way that they do with all immature glycoproteins; however, because CD45 is a highly expressed, multivalent ligand, we are able to detect the association. Nevertheless, our observations that we are unable to copurify glucosidase II with class I MHC molecules or detect the association of these ER proteins with class I molecules by blotting or enzymatic assay, suggest that there may be something special about the way in which glucosidase II interacts with CD45. Moreover, it is notable that we failed to copurify detectable levels of any other enzyme or receptor that recognizes oligosaccharides present on CD45, or any other ER chaperone molecule that interacts with CD45.

It is also possible that our data may relate to novel aspects of CD45 maturation or function. That maturation of CD45 is highly unconventional in some cell types is revealed by a report demonstrating the presence of high mannose triantennary oligosaccharide linkages on cell-surface CD45 derived from immature thymocytes (52). It has further been noted that in a resting T-cell line approximately 30% of total cellular CD45 is retained in the cis-Golgi (53). Within minutes of activating this cell with anti-Thy-1, this intracellular pool of CD45 was found to disperse, partitioning to an insoluble intracellular fraction. It is tempting to speculate that a novel function of glucosidase II may be to target and/or retain a portion of newly synthesized CD45, possibly in a transitional ER compartment. It is not clear whether the PTP activity of the cytoplasmic domain of CD45 may be required to perform a function in this particular subcellular microenvironment; however, it is interesting that the cytosolic phosphatase, PTP1B, has been shown to localize to the endoplasmic reticulum (54). In addition, tyrosine kinase and phosphatase inhibitors can block vesicular transport (55). Also intriguing, particularly in view of the fact that GIIbeta may bind Ca2+, is a report detailing defects in regulation of intracellular Ca2+ by cells deficient in CD45 (56) and another indicating that re-distribution of intracellular pools of CD45 correlates with changes in the ability of T cells to liberate Ca2+ from internal stores (57). Further investigation of the interactions between CD45 and glucosidase II may provide novel insights into the functions of these molecules.


FOOTNOTES

*   This work was supported in part by the Medical Research Council of Canada.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

The nucleotide sequence(s) reported in this paper has been submitted to the GenBankTM/EMBL Data Bank with accession number(s) U92793[GenBank] and U92794[GenBank].


Dagger    Supported by studentships from the Natural Sciences and Engineering Research Council of Canada and the Alberta Heritage Foundation for Medical Research.
§   Scholar of the Medical Research Council of Canada and senior scholar of the Alberta Heritage Foundation for Medical Research. To whom correspondence should be addressed. Tel.: 403-492-7710; Fax: 403-492-7521; E-mail: hanne.ostergaard{at}ualberta.ca.
1   The abbreviations used are: PTP, protein-tyrosine phosphatase; DOC, sodium deoxycholate; Endo, endoglycosidase; ER, endoplasmic reticulum; GII, glucosidase II; kb, kilobase(s); H-LAG, human lysosomal alpha -glucosidase; MHC, major histocompatibility complex; ORF, open reading frame; PAGE, polyacrylamide gel electrophoresis; PCR, polymerase chain reaction; RACE, rapid amplification of cDNA ends; RT, reverse transcriptase.

ACKNOWLEDGEMENTS

We thank Dr. Robert Hyman for the CD45+ and CD45- BW5147 and SAKRTLS 12.1 cell lines and Yew Hon Lai for assistance with the DNA hybridizations. We also acknowledge the excellent sequencing work of the Alberta Peptide Institute and the University of Alberta, Department of Biochemistry DNA Sequencing Facility and extend our gratitude to Dr. Kevin Kane for his critical review of the manuscript.


REFERENCES

  1. Trowbridge, I. S., and Thomas, M. L. (1994) Annu. Rev. Immunol. 12, 85-116 [CrossRef][Medline] [Order article via Infotrieve]
  2. Thomas, M. L. (1989) Annu. Rev. Immunol. 7, 339-369 [CrossRef][Medline] [Order article via Infotrieve]
  3. Pulido, R., and Sanchez-Madrid, F. (1990) Eur. J. Immunol. 20, 2667-2671 [Medline] [Order article via Infotrieve]
  4. Kishihara, K., Penninger, J., Wallace, V. A., Kundig, T. M., Kawai, K., Wakeham, A., Timms, E., Pfeffer, K., Ohashi, P. S., Thomas, M. L., Furlonger, C., Paige, C. J., and Mak, T. W. (1993) Cell 74, 143-156 [CrossRef][Medline] [Order article via Infotrieve]
  5. Byth, K. F., Conroy, L. A., Howlett, S., Smith, A. J. H., May, J., Alexander, D. R., and Holmes, N. (1996) J. Exp. Med. 183, 1707-1718 [Abstract/Free Full Text]
  6. Arendt, C. W., and Ostergaard, H. L. (1995) J. Biol. Chem. 270, 2313-2319 [Abstract/Free Full Text]
  7. Trombetta, E. S., Simons, J. F., and Helenius, A. (1996) J. Biol. Chem. 271, 27509-27516 [Abstract/Free Full Text]
  8. Hyman, R., Trowbridge, I., Stallings, V., and Trotter, J. (1982) Immunogenetics 15, 413-420 [CrossRef][Medline] [Order article via Infotrieve]
  9. Trowbridge, I. S. (1978) J. Exp. Med. 148, 313-323 [Abstract/Free Full Text]
  10. Laemmli, U. K. (1970) Nature 227, 680-685 [CrossRef][Medline] [Order article via Infotrieve]
  11. Sakai, K., Hirai, M., Minoshima, S., Kudoh, J., Fukuyama, R., and Shimizu, N. (1989) Genomics 5, 309-315 [CrossRef][Medline] [Order article via Infotrieve]
  12. Altschul, S. F., Gish, W., Miller, W., Myers, E. W., and Lipman, D. J. (1990) J. Mol. Biol. 215, 403-410 [CrossRef][Medline] [Order article via Infotrieve]
  13. Kozak, M. (1986) Cell 44, 283-292 [CrossRef][Medline] [Order article via Infotrieve]
  14. Ugalde, R. A., Staneloni, R. J., and Leloir, L. F. (1978) FEBS Lett. 91, 209-212 [CrossRef][Medline] [Order article via Infotrieve]
  15. Burns, D. M., and Touster, O. (1982) J. Biol. Chem. 257, 9991-10000 [Abstract/Free Full Text]
  16. Hino, Y., and Rothman, J. E. (1985) Biochemistry 24, 800-805 [CrossRef][Medline] [Order article via Infotrieve]
  17. Kaushal, G. P., Zeng, Y., and Elbein, A. D. (1993) J. Biol. Chem. 268, 14536-14542 [Abstract/Free Full Text]
  18. Brada, D., and Dubach, U. C. (1984) Eur. J. Biochem. 141, 149-156 [Medline] [Order article via Infotrieve]
  19. Henrissat, B. (1991) Biochem. J. 280, 309-316
  20. Henrissat, B., and Bairoch, A. (1993) Biochem. J. 293, 781-788
  21. Hoefsloot, L., Hoogeveen-Westerveld, M., Kroos, M. A., van Beeumen, J., Reuser, A. J. J., and Oostra, B. A. (1988) EMBO J. 7, 1697-1704 [Medline] [Order article via Infotrieve]
  22. Hermans, M. M. P., Kroos, M. A., van Beeumen, J., Oostra, B. A., and Reuser, A. J. J. (1991) J. Biol. Chem. 266, 13507-13512 [Abstract/Free Full Text]
  23. Quaroni, A., and Semenza, G. (1976) J. Biol. Chem. 251, 3250-3253 [Abstract/Free Full Text]
  24. Kinsella, B. T., Hogan, S., Larkin, A., and Cantwell, B. A. (1991) Eur. J. Biochem. 202, 657-664 [Medline] [Order article via Infotrieve]
  25. Naim, H. Y., Niermann, T., Kleinhans, U., Hollenberg, C. P., and Strasser, A. W. M. (1991) FEBS Lett. 294, 109-112 [CrossRef][Medline] [Order article via Infotrieve]
  26. Sugimoto, M., and Suzuki, Y. (1996) J. Biochem. (Tokyo) 119, 500-505 [Abstract/Free Full Text]
  27. Jeffrey, P. L., Brown, D. H., and Illingworth Brown, B. (1970) Biochemistry 9, 1403-1415 [CrossRef][Medline] [Order article via Infotrieve]
  28. Palmer, T. N. (1971) Biochem. J. 124, 701-711 [Medline] [Order article via Infotrieve]
  29. Ugalde, R. A., Staneloni, R. J., and Leloir, L. F. (1980) Eur. J. Biochem. 113, 97-103 [Medline] [Order article via Infotrieve]
  30. Semenza, G. (1986) Annu. Rev. Cell Biol. 2, 255-313 [CrossRef]
  31. Yang, Z., Makita, Z., Horii, Y., Brunelle, S., Cerami, A., Sehajpal, P., Suthanthiran, M., and Vlassara, H. (1991) J. Exp. Med. 174, 515-524 [Abstract/Free Full Text]
  32. Goh, K. C., Lim, Y. P., Ong, S. H., Siak, C. B., Cao, X., Tan, Y. H., and Guy, G. R. (1996) J. Biol. Chem. 271, 5832-5838 [Abstract/Free Full Text]
  33. Wilson, D. W., Lewis, M. J., and Pelham, H. R. B. (1993) J. Biol. Chem. 268, 7465-7468 [Abstract/Free Full Text]
  34. Ozawa, M., and Muramatsu, T. (1993) J. Biol. Chem. 268, 699-705 [Abstract/Free Full Text]
  35. Weis, K., Griffiths, G., and Lamond, A. I. (1994) J. Biol. Chem. 269, 19142-19150 [Abstract/Free Full Text]
  36. Fliegel, L., Ohnishi, M., Carpenter, M. R., Khanna, V. K., Reithmeier, R. A. F., and MacLennan, D. H. (1987) Proc. Natl. Acad. Sci. U. S. A. 84, 1167-1171 [Abstract/Free Full Text]
  37. Smith, M. J., and Koch, G. L. E. (1989) EMBO J. 8, 3581-3586 [Medline] [Order article via Infotrieve]
  38. Sonnichsen, B., Fullekrug, J., Nguyen Van, P., Diekmann, W., Robinson, D. G., and Mieskes, G. (1994) J. Cell Sci. 107, 2705-2717 [Abstract]
  39. Kretsinger, R. H. (1980) Crit. Rev. Biochem. 8, 119-174 [Medline] [Order article via Infotrieve]
  40. Ginna, L. S., and Robbins, P. W. (1979) J. Biol. Chem. 254, 8814-8818 [Abstract/Free Full Text]
  41. Lucocq, J. M., Brada, D., and Roth, J. (1986) J. Cell Biol. 102, 2137-2146 [Abstract/Free Full Text]
  42. Kornfeld, R., and Kornfeld, S. (1985) Annu. Rev. Biochem. 54, 631-664 [CrossRef][Medline] [Order article via Infotrieve]
  43. Hammond, C., Braakman, I., and Helenius, A. (1994) Proc. Natl. Acad. Sci. U. S. A. 91, 913-917 [Abstract/Free Full Text]
  44. Kearse, K. P., Williams, D. B., and Singer, A. (1994) EMBO J. 13, 3678-3686 [Medline] [Order article via Infotrieve]
  45. Herbert, D. N., Foellmer, B., and Helenius, A. (1995) Cell 81, 425-433 [CrossRef][Medline] [Order article via Infotrieve]
  46. Ora, A., and Helenius, A. (1995) J. Biol. Chem. 270, 26060-26062 [Abstract/Free Full Text]
  47. Michael, J. M., and Kornfeld, S. (1980) Arch. Biochem. Biophys. 199, 249-258 [CrossRef][Medline] [Order article via Infotrieve]
  48. Hirai, M., and Shimizu, N. (1990) Biochem. J. 270, 583-589 [Medline] [Order article via Infotrieve]
  49. Stumpo, D. J., Graff, J. M., Albert, K. A., Greengard, P., and Blackshear, P. J. (1989) Proc. Natl. Acad. Sci. U. S. A. 86, 4012-4016 [Abstract/Free Full Text]
  50. Harlan, D. M., Graff, J. M., Stumpo, D. J., Eddy, R. L., Jr., Shows, T. B., Boyle, J. M., and Blackshear, P. J. (1991) J. Biol. Chem. 266, 14399-14405 [Abstract/Free Full Text]
  51. Li, Y. M., Mitsuhashi, T., Wojciechowicz, D., Shimizu, N., Li, J., Stitt, A., He, C., Banerjee, D., and Vlassara, H. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 11047-11052 [Abstract/Free Full Text]
  52. Uemura, K., Yokota, Y., Kozutsumi, Y., and Kawasaki, T. (1996) J. Biol. Chem 271, 4581-4584 [Abstract/Free Full Text]
  53. Minami, Y., Stafford, F. J., Lippincott-Schwartz, J., Yuan, L. C., and Klausner, R. D. (1991) J. Biol. Chem. 266, 9222-9230 [Abstract/Free Full Text]
  54. Frangioni, J. V., Beahm, P. H., Shifrin, V., Jost, C. A., and Neel, B. G. (1992) Cell 68, 545-560 [CrossRef][Medline] [Order article via Infotrieve]
  55. Austin, C. D., and Shields, D. (1996) J. Cell Biol. 135, 1471-1483 [Abstract/Free Full Text]
  56. Volarevic, S., Niklinska, B. B., Burns, C. M., Yamada, H., June, C. H., Dumont, F. J., and Ashwell, J. D. (1992) J. Exp. Med. 176, 835-844 [Abstract/Free Full Text]
  57. Shivnan, E., Clayton, L., Alldridge, L., Keating, K. E., Gullberg, M., and Alexander, D. R. (1996) J. Immunol. 157, 101-109 [Abstract]

©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Appl. Environ. Microbiol.Home page
S. Geysens, T. Pakula, J. Uusitalo, I. Dewerte, M. Penttila, and R. Contreras
Cloning and Characterization of the Glucosidase II Alpha Subunit Gene of Trichoderma reesei: a Frameshift Mutation Results in the Aberrant Glycosylation Profile of the Hypercellulolytic Strain Rut-C30
Appl. Envir. Microbiol., June 1, 2005; 71(6): 2910 - 2924.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
J. Feng, A. V. Romaniouk, S. K. Samal, and I. K. Vijay
Processing enzyme glucosidase II: proposed catalytic residues and developmental regulation during the ontogeny of the mouse mammary gland
Glycobiology, October 1, 2004; 14(10): 909 - 921.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. ProteomicsHome page
O. Loseva and Y. Engstrom
Analysis of Signal-dependent Changes in the Proteome of Drosophila Blood Cells During an Immune Response
Mol. Cell. Proteomics, August 1, 2004; 3(8): 796 - 808.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
D. Gkika, F. Mahieu, B. Nilius, J. G. J. Hoenderop, and R. J. M. Bindels
80K-H as a New Ca2+ Sensor Regulating the Activity of the Epithelial Ca2+ Channel Transient Receptor Potential Cation Channel V5 (TRPV5)
J. Biol. Chem., June 18, 2004; 279(25): 26351 - 26357.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
V. S. Reddy, G. S. Ali, and A. S. N. Reddy
Genes Encoding Calmodulin-binding Proteins in the Arabidopsis Genome
J. Biol. Chem., March 15, 2002; 277(12): 9840 - 9852.
[Abstract] [Full Text] [PDF]


Home page
J. Immunol.Home page
T. A. Baldwin and H. L. Ostergaard
Developmentally Regulated Changes in Glucosidase II Association with, and Carbohydrate Content of, the Protein Tyrosine Phosphatase CD45
J. Immunol., October 1, 2001; 167(7): 3829 - 3835.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
M. F. Pelletier, A. Marcil, G. Sevigny, C. A. Jakob, D. C. Tessier, E. Chevet, R. Menard, J. J.M. Bergeron, and D. Y. Thomas
The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo
Glycobiology, August 1, 2000; 10(8): 815 - 827.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
C. W. Arendt and H. L. Ostergaard
Two distinct domains of the {beta}-subunit of glucosidase II interact with the catalytic {alpha}-subunit
Glycobiology, May 1, 2000; 10(5): 487 - 492.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
K. Treml, D. Meimaroglou, A. Hentges, and E. Bause
The {alpha}- and {beta}-subunits are required for expression of catalytic activity in the hetero-dimeric glucosidase II complex from human liver
Glycobiology, May 1, 2000; 10(5): 493 - 502.
[Abstract] [Full Text] [PDF]


Home page
Biol. Reprod.Home page
S. Brûlé, F. Rabahi, R. Faure, J.-F. Beckers, D. W. Silversides, and J. G. Lussier
Vacuolar System-Associated Protein-60: A Protein Characterized from Bovine Granulosa and Luteal Cells That Is Associated with Intracellular Vesicles and Related to Human 80K-H and Murine {beta}-Glucosidase II
Biol Reprod, March 1, 2000; 62(3): 642 - 654.
[Abstract] [Full Text]


Home page
Mol. Biol. CellHome page
D. E. Cikaluk, N. Tahbaz, L. C. Hendricks, G. E. DiMattia, D. Hansen, D. Pilgrim, and T. C. Hobman
GERp95, a Membrane-associated Protein that Belongs to a Family of Proteins Involved in Stem Cell Differentiation
Mol. Biol. Cell, October 1, 1999; 10(10): 3357 - 3372.
[Abstract] [Full Text]


Home page
J. Biol. Chem.Home page
C. D'Alessio, F. Fernandez, E. S. Trombetta, and A. J. Parodi
Genetic Evidence for the Heterodimeric Structure of Glucosidase II. THE EFFECT OF DISRUPTING THE SUBUNIT-ENCODING GENES ON GLYCOPROTEIN FOLDING
J. Biol. Chem., September 3, 1999; 274(36): 25899 - 25905.
[Abstract] [Full Text] [PDF]


Home page
Plant Physiol.Home page
J. D. Monroe, C. M. Gough, L. E. Chandler, C. M. Loch, J. E. Ferrante, and P. W. Wright
Structure, Properties, and Tissue Localization of Apoplastic alpha -Glucosidase in Crucifers
Plant Physiology, February 1, 1999; 119(2): 385 - 398.
[Abstract] [Full Text]


Home page
Mol. Biol. CellHome page
T. C. Hobman, B. Zhao, H. Chan, and M. G. Farquhar
Immunoisolation and Characterization of a Subdomain of the Endoplasmic Reticulum That Concentrates Proteins Involved in COPII Vesicle Biogenesis
Mol. Biol. Cell, June 1, 1998; 9(6): 1265 - 1278.
[Abstract] [Full Text]


Home page
CROBMHome page
M.A. Kukuruzinska and K. Lennon
Protein N-Glycosylation: Molecular Genetics and Functional Significance
Critical Reviews in Oral Biology & Medicine, January 1, 1998; 9(4): 415 - 448.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. A. Baldwin, M. Gogela-Spehar, and H. L. Ostergaard
Specific Isoforms of the Resident Endoplasmic Reticulum Protein Glucosidase II Associate with the CD45 Protein-tyrosine Phosphatase via a Lectin-like Interaction
J. Biol. Chem., October 6, 2000; 275(41): 32071 - 32076.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Arendt, C. W.
Right arrow Articles by Ostergaard, H. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Arendt, C. W.
Right arrow Articles by Ostergaard, H. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1997 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement