![]()
|
|
||||||||
(Received for publication, March 18, 1997, and in revised form, May 20, 1997)
From the The x-ray crystal structure of recombinant
leech-derived tryptase inhibitor (rLDTI) has been solved to a
resolution of 1.9 Å in complex with porcine trypsin. The nonclassical
Kazal-type inhibitor exhibits the same overall architecture as that
observed in solution and in rhodniin. The complex reveals structural
aspects of the mast cell proteinase tryptase. The conformation of the binding region of rLDTI suggests that tryptase has a restricted active
site cleft. The basic amino terminus of rLDTI, apparently flexible from
previous NMR measurements, approaches the 148-loop of trypsin. This
loop has an acidic equivalent in tryptase, suggesting that the basic
amino terminus could make favorable electrostatic interactions with the
tryptase molecule. A series of rLDTI variants constructed to probe this
hypothesis confirmed that the amino-terminal Lys-Lys sequence plays a
role in inhibition of human lung tryptase but not of trypsin or
chymotrypsin. The location of such an acidic surface patch is in
accordance with the known low molecular weight inhibitors of
tryptase.
Tryptase is the major protein component of mast cell granules (1).
In contrast to many other trypsin-like serine proteinases, tryptase is
present in the granules in an active form. Human mast cell tryptase is
catalytically active as a tetramer, stabilized by heparin proteoglycans
from the mast cells that are stored and secreted together with the
protease. Human tryptase is unique inasmuch as no endogenous inhibitors
have yet been detected for this enzyme, although rat tryptase has been
shown to be inhibited by trypstatin (2), a fragment of the
inter- The physiological roles of tryptase are as yet unclear, although
in vitro studies have implicated its function in
neuropeptide turnover, coagulation, and the catabolism of extracellular
matrix proteins (reviewed in Ref. 1). The central role of mast cells in
allergic and inflammatory reactions suggests that tryptase may be
involved in the pathogenesis of disorders such as asthma, interstitial
lung diseases, psoriasis, arthritis, gingivitis, and peridontitis. Only
a few synthetic inhibitors of tryptase have been reported so far
(13-15). Knowledge of the tryptase structure would be of great benefit
for the design of pharmacologically active lead compounds in the
development of drugs for the treatment of these diseases. Attempts have
been made to model the structure of human mast cell tryptase (16) and
the corresponding mouse enzyme (17) by homology to other serine
proteinases. These studies indicate the location of putative heparin
binding sites and suggest that the limited activity of human tryptase
may be due to a restricted active site cleft. Attempts to crystallize
tryptase have been unsuccessful to date, presumably due to the
requirement of (generally heterogeneous) glycosaminoglycans for
stability.
We have recently identified and characterized leech-derived tryptase
inhibitor (LDTI),1 a
protein-type inhibitor of human mast cell tryptase from the medicinal
leech Hirudo medicinalis, (18) and have expressed it in
Saccharomyces cerevisiae (19). LDTI inhibits tryptase with a
Ki of 1.4 nM and, in addition, trypsin
and chymotrypsin in the nanomolar range. Together with the plasmin
inhibitor bdellin B-3 from H. medicinalis (20) and the
thrombin inhibitor rhodniin from Rhodnius prolixus (21),
LDTI belongs to a small group of nonclassical Kazal-type inhibitors
related to, for example, the Japanese quail ovomucoid inhibitor (22)
but exhibiting a distinctive disulfide pattern (Table
I). We have recently solved the structure of rLDTI in solution (23) and that of rhodniin in complex with thrombin
(24).
Table I.
Sequences of Kazal-type inhibitors, aligned according to cysteines
Volume 272, Number 32,
Issue of August 8, 1997
pp. 19931-19937
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.
IMPLICATIONS FOR THE STRUCTURE OF HUMAN MAST CELL TRYPTASE AND
ITS INHIBITION*
§¶,
,
,
,
,
Max-Planck-Institut für Biochemie, Am
Klopferspitz, D-82152 Martinsried bei München, Germany,
§ Abteilung für Klinische Chemie und Klinische
Biochemie in der Chirurgischen Klinik und Poliklinik, Klinikum
Innenstadt der Ludwig-Maximilians-Universität München,
D-80336 München, Germany,
Klinikum der Universität
Jena, Zentrum für Vaskuläre Biologie und Medizin,
Nordhäuserstr. 78, D-99089 Erfurt, Germany
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES
-trypsin inhibitor (3). Regulation of human tryptase activity
is thought to be mediated by dissociation of the tetramer, a process
that may be accelerated by competition for heparin between the protease
and other heparin-binding proteins. Human mast cell tryptase has been isolated from lung (4, 5), skin (6), pituitary (7), and a mast cell
leukemia cell line (8). Two cDNAs have been cloned from human lung
(HLT
and HLT
) (9, 10) and three from human skin (HST1, HST2, and
HST3) (11), where HLT
and HST2 possess the same sequence. Recent
data suggest that different isoforms may exhibit differences in their
specificities (12).
-helix) and b (
-sheet). Residues mutated in this work are in boldface type.
Secondary structure
* bbb bb aaaaaaa bbbb
LDTI
KKVCA------C-PKILKPVCGSDGRTYANSCIARCNG------VSIKSEGSCPTGILN
BDB3
DTGCV------C-TKELHRVCGSDGVTYDNECLATCHG------ASVAHDHACEGHEEHVDEHGEDHD
RHOD1
EGGEPCA------C-PHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDE
RHOD2
DVCQE-----CDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT
JPQ
LAAVSVDCSEYPKPAC-PKDYRPVCGSDNKTYSNKCNFCNAVVESNGTLTLNHFGKC
In this paper, we describe the crystal structure of rLDTI in complex
with porcine trypsin, solved to a resolution of 1.9 Å. The compact
molecule binds to the active site of trypsin in a canonical
(i.e. substrate-like) manner. Its distinctive disulfide pattern results in a disk-shaped molecule that suggests a restricted active site cleft of tryptase. The deletion of one turn of
-helix allows the amino-terminal residues to follow a path along the surface
of the proteinase novel for Kazal-type inhibitors. Based on the
structure, we have used site-directed mutagenesis to establish a
specific role of the amino-terminal basic residues of LDTI in its
interaction with human lung tryptase. The implications of these results
for the structure and inhibition of tryptase are discussed.
The chemicals used were of the highest quality available commercially from the following sources: Sigma, Merck (Darmstadt, Germany), Serva (Heidelberg, Germany), Biomol (Hamburg, Germany), Roth (Karlsruhe, Germany), Braun (Melsungen, Germany), Dianova (Hamburg, Germany), and Promega (Madison, WI).
Restriction endonucleases and DNA-modifying enzymes were purchased from the following sources: Boehringer Mannheim GmbH (Mannheim, Germany), New England Biolabs (Beverly, MA), and Pharmacia-Biotech (Freiburg, Germany).
Bacto-tryptone, Bacto-peptone, Bacto-yeast nitrogen base, Bacto-yeast extract, and Bacto-agar were from Difco (Augsburg, Germany).
rLDTI was isolated according to the procedure in Ref. 19, and human lung tryptase was isolated as described in Ref. 18.
Bovine pancreatic trypsin; human thrombin; and the substrates Tos-Gly-Pro-Arg-pNA (tryptase), Bz-Ile-Glu-Gly-Arg-pNA (trypsin), and Suc-Val-Pro-Phe-pNA (chymotrypsin) were purchased from Sigma.
Oligonucleotides were purchased from Pharmacia. The Escherichia coli-S. cerevisiae shuttle and expression vector pVT102U/a and the yeast strain S-78 were kindly provided by T. Vernet (Biotechnology Research Institute, Montreal, Canada) and by C.-W. Chi and Y.-S. Zhang (Shanghai Institute of Biochemistry, China) (25, 26). The other E. coli strains and vector constructions harboring rLDTI are described in Ref. 19.
Crystallization and Structure SolutionAn excess of rLDTI
was added to porcine trypsin (Sigma) in 20 mM MOPS, 20 mM NaCl, pH7, and the resulting complex was concentrated to
10 mg/ml. Ellipsoidal crystals of the complex were obtained using vapor
diffusion with 10% polyethylene glycol 6000, 2.3 M phosphate, pH 8. The crystals belong to the tetragonal space group P43212 with cell constants a = b = 63.4 Å, c = 131.2 Å,
=
=
= 90° and contain one complex in the asymmetric unit. Data to
1.9-Å resolution were collected on an image plate (MAR Research, Hamburg) and evaluated using Mosflm (27) from the CCP4 package. A total
of 139,563 reflections (21,466 independent reflections, 98.6% complete
to 1.9 Å) were measured with an overall Rsym of 0.082. The structure was solved using AMoRe (28), with the trypsin component of the porcine trypsin-mung bean inhibitor complex (29) as
starting model. Successive rounds of model building using the program O
(30) and refinement using the program X-PLOR (31) parameterized
according to Ref. 32 allowed the positioning of all 223 trypsin
residues, 31 of LDTI's 46 residues, 149 water molecules, and 1 calcium
ion. The final model has a crystallographic R-factor of
0.197 for all reflections to 1.9 Å, and consists of 1996 active atoms,
with root mean square deviations of 0.008 Å in bond lengths and
1.805° in bond angles and an average temperature factor of 21 Å2.
Standard techniques of molecular cloning were performed
according to Ref. 33, with DNA sequencing and yeast genetic methods according to Ref. 34. The deletion variants rLDTI-var1 and rLDTI-var2 and the substitution variant rLDTI-var3 were constructed by cassette mutagenesis using the cloning vector pRM 5.1.5 (19). Briefly, after
cleavage of vector DNA with XbaI/BglII, the small
fragment coding for the fusion linker and the N terminus of rLDTI was
substituted by appropriate hybridized oligonucleotides (cassettes). The
oligonucleotide sequences for the XbaI/BglII
fragments were 5
-CTA GAT AAA AGA AAG GTT TGC GCA TGC CCA AA and
complementary 3
-TA TTT TCT TTC CAA ACG CGT ACG GGT TTC TAG for
rLDTI-var1 (
K1); 5
-CTA GAT AAA AGA GTT TGC GCA TGC CCA AA and
complementary 3
-TA TTT TCT CAA ACG CGT ACG GGT TTC TAG for rLDTI-var2
(
K1,
K2); and 5
-CTA GAT AAA AGA CAA CAA GTT TGC GCA TGC CCA AA
and complementary 3
-TA TTT TCT GTT GTT CAA ACG CGT ACG GGT TTC TAG for
rLDTI-var3 (K1Q, K2Q). The resulting cloning vectors (pRM 16.1.4, pRM
17.1.2, and pRM 18.1.2, respectively) were amplified in E. coli TG1.
For expression in S. cerevisiae, the mutated rLDTI genes
were isolated by XbaI/HindIII cleavage and
ligated into yeast shuttle vector pVT102U/
. The resulting expression
vectors pRM 20.2.1, pRM 21.2.1, and pRM 22.2.1 were used to transform
S. cerevisiae S-78 (35). Standard yeast expression
experiments were performed as described in Ref. 19. Procedures for the
mutagenesis, expression, and purification of the thrombin-directed
mutants rLDTI-var
1, rLDTI-var
2, rLDTI-var
3, rLDTI-var
4, and
rLDTI-var
5 are described in the accompanying paper (36).
Protein isolation and purification was performed as described (18, 19) with the following modifications in cation exchange chromatography buffers: 20 mM NaH2PO4, pH 7.3, for rLDTI-var1 and 20 mM NaH2PO4, pH 7.0, for rLDTI-var2 and rLDTI-var3.
SDS-polyacrylamide gel electrophoresis of proteins was performed with 15-25% polyacrylamide gels (37). The gels were self-prepared and run in either a conventional apparatus or the PhastSystem® (Pharmacia). Isoelectric focussing was performed with the PhastSystem® using the calibration kit, pH 3.5-9.3, from Pharmacia.
Selected fractions from the cation exchange chromatography, usually 2-3 nmol of protein, were analyzed by reversed phase HPLC as detailed previously (18). Partial N-terminal sequence analysis was performed with the gas phase sequencer 473A (Applied Biosystems GmbH, Weiterstadt, Germany) following the instructions of the manufacturer.
The protein concentration was determined using the Pierce BCA* protein assay with bovine serum albumin as standard protein (38) or by measuring the absorbance at 280 nm and using theoretical values for aromatic residues and cystines according to Ref. 39 (A280 (1%) value of 3.46 for all rLDTI variants and of 10.0 for protein mixtures).
Mass SpectrometryReverse phase HPLC-purified protein fractions were infused into an atmospheric pressure ionization source fitted to a tandem quadrupole instrument, API III (Sciex, Thornhill, Ontario, Canada). The sample solutions were delivered to the sprayer by a syringe infusion pump (model 22, Harvard Apparatus, Inc., South Natick, MA). The liquid flow rate was set at 5 ml/min for sample introduction. The instrument m/z scale was calibrated with the ammonium adduct ions of polypropylene gycol. The average molecular mass values of the protein were calculated from the m/z peaks in the charge distribution profiles of the multiple charged ions (40, 41). Theoretical masses for the variants were calculated assuming three disulfide bridges with the GCG DNA/protein analysis software (42).
Enzymatic MeasurementsThe concentrations of the
biologically active LDTI variants were determined by titration with
trypsin, assuming an equimolar interaction between each inhibitor and
the enzyme. Bovine pancreatic trypsin was standardized by active site
titration using p-nitrophenyl p
-guanidinobenzoate (43).
Equilibrium dissociation constants (Ki) were determined essentially as suggested by Bieth (44). Briefly, a constant concentration of bovine pancreatic trypsin, chymotrypsin, or tryptase isolated from human lung tissue (in the presence of 50 µg/ml heparin to stabilize the protease) was incubated with increasing concentrations of each inhibitor; the time necessary to reach equilibration of the enzyme-inhibitor complex was determined in preliminary experiments. Subsequently, the residual enzyme activities were measured by following the hydrolysis of suitable substrates. Apparent Ki values (Ki (app)) were calculated by fitting the steady state velocities to the equation for tight binding inhibitors (45) using nonlinear regression analysis as follows,
|
(Eq. 1) |
Equilibrium dissociation constants (Ki) for the complexes of the LDTI variants with chymotrypsin were obtained from the Ki app values after correction for competition between the inhibitors and the substrate; even at high substrate concentrations competition was not detectable during the measurements of residual enzyme activities of tryptase and trypsin.
Ki values for the inhibition of tryptase and factor
Xa by the low molecular weight inhibitors TPDCA and DX9065a (Fig. 4)
were calculated according to Dixon (46) from data measured at pH 7.6 and 25 °C using the chromogenic substrate Tos-Gly-Pro-Arg-pNA.
Apart from a few surface-located side chains, the trypsin
moiety is almost completely defined by electron density. With the exception of the side chain of Tyr217, which swings out to
accommodate the amino-terminal residues of LDTI (Fig.
1; see below), no significant
conformational changes are seen in the trypsin component compared with
other porcine trypsin structures (29, 47-49). The LDTI moiety is well
defined in the vicinity of the proteinase, but it is characterized by elevated temperature factors and disrupted density further away from
trypsin. In particular, amino acid residues
Lys1-Lys2,
Gly15-Arg19,
Ser33-Ser36, and the C-terminal residues
Pro41-Asn46 are defined by either weak or no
electron density. In contrast, the NMR solution structure (23) is well
defined for residues Cys4-Cys40, while the
terminal peptides Lys1-Val3 and
Pro41-Asn46 are mobile.
LDTI secondary structure consists of a short central
-helix
(Ser24-Asn30) and a small antiparallel
-sheet (residues Val13-Gly15,
Thr20-Tyr21, and
Ile34-Glu37) characteristic for the classical
Kazal-type inhibitors (Fig. 2). Due to a
large deletion, however, the helix is one turn shorter than that in
Japanese quail ovomucoid third domain (22) or either domain of rhodniin
(24) (Fig. 2). The third
-strand is in part poorly defined,
suggesting a degree of flexibility in the crystal. Residues P3-P3
(Cys6-Lys11) exhibit the highly conserved
"canonical" or substrate-like conformation of the small serine
proteinase inhibitors (50). As a result of its "nonclassical"
disulfide pattern, the active site wedge of LDTI is rather narrow, as
was also observed for rhodniin (24). In contrast to either of the two
domains of rhodniin, however, the first disulfide bridge
(Cys4-Cys29) possesses a right handed spiral
conformation that causes the amino terminus to exit the active site
cleft to the "south," rather than to the "west" (Fig. 1). Such
a conformation of the disulfide is sterically hindered in rhodniin and
Japanese quail ovomucoid third domain, since it would result in a clash
of the amino-terminal residues with those of the longer
-helix.
atoms of the
Kazal-type inhibitors LDTI (thick lines), Japanese quail
ovomucoid third domain (22) (medium lines), and rhodniin's
first domain (24) (thin lines). The reactive site loop
runs from left to right at the bottom
of the figure, with the side chain of the P1
residue (Lys in LDTI and Japanese quail ovomucoid; His in rhodniin)
shown. The three cystines that correspond in LDTI to
Cys4-Cys29,
Cys6-Cys25, and
Cys14-Cys40 are labeled A1,
B, and C, respectively; the position of the first cystine in Japanese quail ovomucoid is labeled A2. The amino
termini of all three molecules follow different directions, marked by NL (LDTI), NO (ovomucoid), and NR
(rhodniin). The central helix of LDTI is truncated by one turn with
respect to the other two molecules (labeled
).
Although not well defined, there is sufficient density to show that the
two amino-terminal lysine residues reach out toward the trypsin loop
containing residue 148 (referred to as the "148-loop"). Structure-based sequence alignment of mast cell tryptases with trypsin
(16) reveals this loop to be acidic in the tryptases (see Fig.
3), making it conceivable that the basic
amino terminus of LDTI makes an electrostatic contribution to its
interaction with tryptase. To test this hypothesis, a series of
N-terminally truncated and charge-deleted variants were constructed
using cassette mutagenesis.
Expression of Variants
The yeast expression system gave
yields of the variants of the order of 12 mg/liter, whose purity and
identity were analyzed using SDS-polyacrylamide gel electrophoresis,
isoelectric focusing, and reverse phase HPLC. Correct processing of the
mating type leader fusion protein was verified by partial
N-terminal sequencing in each case. Mass spectroscopy of the variants
yielded major masses for LDTI-var1 of 4609.3 Da (calculated mass,
4609.35 Da), for LDTI-var2 of 4480.8 Da (calculated mass, 4481.18 Da),
and two masses in a 1:1 ratio for LDTI-var3 of 4736.9/4719.4 Da
(calculated mass, 4737.45 Da). The lower mass peak observed for
LDTI-var3 was attributed to partial formation of pyroglutamate.
Variants rLDTI-var1 and rLDTI-var2 both showed an additional minor mass with a reduced value of 114.0 ± 1 Da compared with the major
peak, interpreted as the truncation of the C-terminal Asn46
by endogenous yeast proteinases.
Equilibrium
dissociation constants were measured for each variant with trypsin,
tryptase and chymotrypsin (Table II).
Sequential deletion of the first and second N-terminal lysines
(variants 1 and 2, respectively) had a marked effect on anti-tryptase
activity but only a negligible effect on the interaction with trypsin
or chymotrypsin. This was also the case for the substitution of these residues by the uncharged polar residue glutamine (variant 3), substantiating the positive charge requirement. A series of variants designed to allow thrombin inhibition (see accompanying paper (36))
showed decreased tryptase inhibition. Mutation of four residues in the
reactive site (rLDTI-var
3) resulted in a modest decrease in tryptase
inhibition, as did variant rLDTI-var
2, C-terminally elongated by an
acidic peptide. Tryptase inhibition was effectively abolished in the
remaining C-terminal variants rLDTI-var
1, rLDTI-var
4, and
rLDTI-var
5. Some of these effects were also mirrored in the inhibition of trypsin and chymotrypsin.
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Having established the existence of a negatively charged patch on the tryptase surface to the south of the active site cleft, it was decided to test the inhibition of tryptase by bisamidine inhibitors (Fig. 4). TPDCA inhibits tryptase with a Ki of 0.85 µM, whereas no inhibition could be measured for DX9065a.
The heparin-associated tetrameric tryptase has so far defied attempts at crystallization. In this paper, we present structural and mutagenesis data for rLDTI, a high affinity inhibitor of human tryptase. Using the structure of LDTI as a template, we are able to address aspects of the tryptase structure. Compared with the "classical" Kazal-type inhibitors (e.g. the Japanese quail ovomucoid inhibitor (22)), rLDTI has a narrow disk-like proteinase-binding region. This is a result of its characteristic disulfide pattern, which it shares with rhodniin and bdellin B-3. The structure of the rhodniin-thrombin complex (24) revealed this narrow binding region to be essential for the fit to thrombin's restricted active site cleft, bounded to the "north" by its characteristic 60-insertion loop (51).
According to the structural alignment proposed by Johnson and Barton
(16), tryptase does not possess such a 60-insertion loop. The active
site cleft should, however, be occluded to the west by a pronounced
9-residue insertion with respect to trypsin residues 173-176 (Fig. 3)
immediately after the intermediate helix. The southerly exit of LDTI's
amino-terminal residues from trypsin's active site cleft suggests that
LDTI is favorably adapted to avoid this restriction in tryptase. The
southerly route is made possible by the conformation of disulfide
Cys4-Cys29, in turn facilitated by the
deletion of the last turn in the central
-helix with respect to the
ovomucoid inhibitors or rhodniin (Fig. 2). This disulfide may be in
equilibrium with other conformers in the free inhibitor; a specific
conformation was not observed in the NMR structure due to a lack of
nuclear Overhauser effects constraining the amino terminus (23). An
indication that the right handed spiral conformation might be well
populated in the free inhibitor, and hence of functional significance,
comes from the fact that the side chain of trypsin Tyr217
swings out to accommodate the amino-terminal residues (Fig. 1). In all
other published structures of porcine trypsin (29, 47-49), this side
chain makes favorable stacking interactions with the aromatic side
chain of Tyr172.
The southerly route of the amino-terminal residues would lead to a juxtaposition of the basic Lys1-Lys2 amino terminus with the acidic 148-loop of human tryptases (Fig. 3). Progressive deletion of these residues results in a clear deterioration in inhibitory potency of LDTI for tryptase (Table II), as does their mutation to the neutral Gln1-Gln2 variant. That these mutations had hardly any effect on the inhibition of trypsin and chymotrypsin points strongly to a specific role of electrostatic exosite interactions in the inhibition of tryptase by LDTI.
Such an electrostatic interaction is consistent with the known low
molecular weight inhibitors of tryptase (13-15). The most potent
inhibitors consist of two aromatic amidino functions linked via a
suitable spacer (Fig. 4). Clearly, one amidino function would occupy
the primary specificity pocket of tryptase. It is quite conceivable
that the second amidino moiety could make electrostatic interactions
with the acidic 148-loop, similar to the proposed interaction of
LDTI's amino terminus, with the edge of the aromatic group nestling
against the 173-insertion loop to the west. The crystal structure of
trypsin in complex with bis-benzamidine
(1,1
,3
,1")-terphenyl-3,3"-dicarbamidinium (TPDCA) (52) shows just
such an interaction between the distal amidino group and the side chain
of Asn143. This could explain the inhibition of tryptase by
TPDCA, 2,7-bis-(4-amidinobenzylidene)-cycloheptan-1-one (BABCH), and
bis-(5-amidino-2-benzimidazolyl)methane (BABIM) despite their
differences in size, length, and functional groups.
Coagulation factor Xa is also inhibited by dibasic inhibitors, and indeed most of the compounds shown in Fig. 4 inhibit both tryptase and factor Xa. In factor Xa, however, the receptor for the distal basic moiety is found near the S4 pocket, i.e. toward the northwest of the active site (53, 54), which would be inaccessible in tryptase due to the 173-insertion loop. We hypothesize that these inhibitors must adapt to suit the respective active sites. Comparison of the factor Xa:tryptase inhibition ratios suggests that DX9065a and BABCH prefer a "factor Xa conformation" in solution, while BABIM and TPDCA adopt a "tryptase conformation." The factor Xa-specific inhibitor DX9065a fits ideally to the active site of factor Xa (53, 54); its rigid structure would preclude binding to the south, which is in agreement with its total lack of tryptase inhibitory activity. The particularly low Ki observed for BABIM (13) may be further enhanced by its increased basicity.
Our results suggest a tentative low resolution model for the lining of
the active site cleft of the human tryptase monomer (Fig. 3). LDTI
makes use of two dominant features of tryptase: the restriction of the
active site to the west and an acidic surface patch to the south.
Sequences of tryptase show a further insertion of four predominantly
hydrophobic residues between trypsin residues Tyr39 and
His40 (16) at the eastern edge of the active site cleft
(Fig. 3). This loop may restrict the active site further, which could
explain the marginal decrease in tryptase inhibition by rLDTI-var
3.
Such a conclusion should be considered circumspectly in view of the altered properties of this variant with respect to trypsin and chymotrypsin. In contrast to the C-terminal acidic extension variants rLDTI-var
1, -var
4, and -var
5, rLDTI-var
2 shows only a mild diminution of anti-tryptase activity, comparable with that of the
N-terminal deletion variant rLDTI-var2. The reason for this cannot be
explained by our model of the tryptase monomer; it may reflect
interactions with other subunits of the tetrameric tryptase. Similarly,
the model presented here does not explain the observed 50% maximal
inhibition achieved by LDTI for the cleavage of small substrates by
tryptase; presumably, the binding of LDTI to one monomer of tryptase
precludes access of a further inhibitor molecule to the neighboring
active site in the tetramer.
Although our data do not allow conclusions about the quarternary organization of tryptase or the role played by heparin to be drawn, the model presented here serves as a first step in understanding the structural features of this intriguing enzyme and its inhibition.
The atomic coordinates and structure factors (code 1LDT) have been deposited in the Protein Data Bank, Brookhaven National Laboratory, Upton, NY.
,3
,1")-terphenyl-3,3"-dicarbamidinium; DX9065a,
(+)-2-[4-[((3S)-1-acetimidoyl-3-pyrrodinyl)oxy]phenyl]-3-(7-amidino-2-naphthyl) propionic acid; BABCH,
2,7-bis-(4-amidinobenzylidene)-cycloheptan-1-one; BABIM,
bis-(5-amidino-2-benzimidazolyl)methane; MOPS,
4-morpholinepropanesulfonic acid.
We are grateful to Professors T. Vernet (Biotechnology Research Institute, Montreal, Canada), Cheng-Wu Chi, Zhang You-shaing, and Hu Hong-ming (Shanghai Institute of Biochemistry, China) for providing expression vector pVT102U/a and S. cerevisiae S-78. Amino acid sequencing by Dr. R. Mentele and mass spectroscopy by Dr. C. Eckerskorn in the laboratory of Prof. F. Lottspeich are gratefully acknowledged. Drs. T. Holak and R. Engh are thanked for helpful discussions.
This article has been cited by other articles:
![]() |
M. T. Morris, A. Coppin, S. Tomavo, and V. B. Carruthers Functional Analysis of Toxoplasma gondii Protease Inhibitor 1 J. Biol. Chem., November 15, 2002; 277(47): 45259 - 45266. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Heifetz, E. Katchalski-Katzir, and M. Eisenstein Electrostatics in protein-protein docking Protein Sci., March 1, 2002; 11(3): 571 - 587. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. P. Sommerhoff, W. Bode, P. J. B. Pereira, M. T. Stubbs, J. Sturzebecher, G. P. Piechottka, G. Matschiner, and A. Bergner The structure of the human beta II-tryptase tetramer: Fo(u)r better or worse PNAS, September 28, 1999; 96(20): 10984 - 10991. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Reverter, J. Vendrell, F. Canals, J. Horstmann, F. X. Aviles, H. Fritz, and C. P. Sommerhoff A Carboxypeptidase Inhibitor from the Medical Leech Hirudo medicinalis. ISOLATION, SEQUENCE ANALYSIS, cDNA CLONING, RECOMBINANT EXPRESSION, AND CHARACTERIZATION J. Biol. Chem., December 4, 1998; 273(49): 32927 - 32933. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Morenweiser, E. A. Auerswald, A. van de Locht, H. Fritz, J. Sturzebecher, and M. T. Stubbs Structure-based Design of a Potent Chimeric Thrombin Inhibitor J. Biol. Chem., August 8, 1997; 272(32): 19938 - 19942. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||