Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Han, J.
Right arrow Articles by Kefalides, N. A.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Han, J.
Right arrow Articles by Kefalides, N. A.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 272, Number 33, Issue of August 15, 1997 pp. 20395-20401
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

A Cell Binding Domain from the alpha 3 Chain of Type IV Collagen Inhibits Proliferation of Melanoma Cells*

(Received for publication, January 10, 1997, and in revised form, May 23, 1997)

Jing Han Dagger , Nobuko Ohno Dagger , Sylvie Pasco §, Jean-Claude Monboisse §, Jacques P. Borel § and Nicholas A. Kefalides Dagger

From the Dagger  Connective Tissue Research Institute, Department of Medicine, University of Pennsylvania, and the University City Science Center, Philadelphia, Pennsylvania 19104, and the § Laboratory of Biochemistry, CNRS EP89, University of Reims, Champagne-Ardenne, F-51095 Reims, France

ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
FOOTNOTES
REFERENCES


ABSTRACT

Our previous studies have shown that a peptide corresponding to the residue sequence 185-203 of the NC1 domain of the alpha 3 chain of basement membrane collagen (type IV) inhibits the activation of polymorphonuclear leukocytes. Peptides from the same region of the alpha 1, alpha 2, alpha 4, and alpha 5(IV) chains did not exhibit this property. Because of the intimate relationship between metastasizing neoplastic cells and vascular as well as epithelial basement membranes, we measured the cell adhesion-promoting activity of peptides from the NC1 domain of type IV collagen and their effect on proliferation of human melanoma cells. We found that peptide alpha 3(IV)185-203 (CNYYSNSYSFWLASLNPER) not only promotes adhesion of human melanoma cells but also inhibits their proliferation. Adhesion increased by 50-60% over control. Melanoma cell proliferation was inhibited by 40% when cells were grown in a medium containing 5 µg/ml peptide for 5 days. Studies showed that replacement of serine in position 189 or 191 by alanine resulted in significantly reduced adhesion. Similarly, serine replacement resulted in reduced ability to inhibit proliferation. Our data suggest that a region of the NC1 domain of the alpha 3(IV) chain, contained within the sequence 185-203, not only specifically promotes adhesion but also inhibits proliferation of melanoma cells. These properties appear to be dependent on the presence of the triplet sequence -SNS- (residues 189-191), which is unique to the alpha 3 chain and may represent an important functional epitope.


INTRODUCTION

Type IV collagen is a major component of basement membranes. The predominant molecular species is a heterotrimer composed of two alpha 1 and one alpha 2 chain. The presence of additional type IV collagen chains, alpha 3(IV), alpha 4(IV), alpha 5(IV), and alpha 6(IV), has been reported (1-6). There is evidence that the latter are distributed in most basement membranes (4, 5). Type IV collagen not only forms the main structural framework of all basement membranes, but also serves as scaffolding for the binding of other basement membrane components (7, 8). One important function of type IV collagen is its ability to promote the adhesion and motility of various normal and transformed cell types (9).

The alpha  chain of type IV collagen has a long collagenous domain of about 1,400 amino acid residues and a non-collagenous domain of about 230 residues at the carboxyl terminus, called the NC1 domain. The NC1 domain is thought to play a key role in the alignment and selection of three alpha  chains forming a triple helical molecule (10, 11). Several studies have focused on the biological activity of the NC1 domain of type IV collagen. One synthetic heparin-binding peptide, Hep-I, originating from NC1 domain of the alpha 1 chain of type IV collagen and containing 12 amino acids, has been reported to promote the adhesion and spreading of bovine aortic endothelial cells (12, 13). A series of synthetic peptides from the NC1 domain of several alpha  chains has been used to map antigenic epitopes on type IV collagen (14). One of these peptides, comprising residues 185-203 of the NC1 domain of the alpha 3(IV) chain, has been shown to inhibit the activation of PMN1 as measured by a reduction in O2- production and proteolytic enzyme release (15).

Neoplastic cells have the ability to invade and metastasize. Because of the intimate relationship between epithelial cells and basement membranes as well as metastatic cells and vascular basement membranes we decided to examine the ability of the NC1 domain of type IV collagen and synthetic peptides from this domain to influence adhesion and proliferation of melanoma cells. Our studies show that a synthetic peptide comprising residues 185-203 of the NC1 domain of the alpha 3(IV) chain promotes adhesion and inhibits proliferation of melanoma cells. Using monoclonal antibodies that recognize the above peptide, we have shown that there is a multifunctional domain within the first 12 amino acids of the residue sequence 185-203 capable of promoting the cell adhesion and inhibition of proliferation. Because synthetic peptides of the same region from the other alpha (IV) chains that lack the triplet -SNS- (residues 189-191) fail to inhibit melanoma cell adhesion and proliferation and because the sequence -SNS- is unique to the alpha 3(IV) chain we can assume that this triplet represents the functional epitope of this peptide.


MATERIALS AND METHODS

Cell Culture

The human melanoma cell lines used in these studies, WM9, WM164, WM136 1A were kindly provided by Dr. Meenhard Herlyn (Wistar Institute, Philadelphia). Metastatic cell lines WM9 and WM164 were derived from an intermediate stage metastatic lesion. WM136 1A was obtained from a late lesion with concomitant distant metastases at the time of tumor removal (16, 17). The above cell cultures were grown in tumor medium (MCDE 153/L-15, 4:1, Sigma) supplemented with 2% fetal bovine serum and insulin (5 µg/ml, Sigma). In addition, other tumor cell lines including two melanoma cell lines (HT-144 and UACC-903), a fibrosarcoma cell line (HT-1080), and an osteosarcoma cell line (MG-63) were used. Normal fibroblasts were used as controls. The latter cultures were grown in Dulbecco's modified Eagle's medium supplemented with 10% fetal bovine serum. All cultures were maintained at 37 °C in a humidified atmosphere containing 95% air and 5% CO2.

Preparation of Synthetic Peptides

Peptides corresponding to several specific sequences of the human NC1 domains of the alpha 1(IV), alpha 2(IV), and alpha 3(IV) chains, comprising the residues 185-203, and alpha 4(IV) (bovine) and alpha 5(IV) chains, comprising the residues 182-200, were synthesized according to the method of Barany and Merrifield (18) at the Protein Chemistry Facility of the University of Pennsylvania. Additional peptides, representing partial sequences of the alpha 3(IV) peptide, i.e. residues 185-196, and 194-203, as well as the alpha 3(IV) peptides, where the serines in positions 189 or 191 were replaced by alanine, were prepared (see Table I).

Table I. Amino acid sequence of synthetic peptides from the NC1 domain of the alpha  chains of type IV collagen and immunologic reactivity by ELISA of the synthetic peptides with monoclonal and polyclonal antibodies (A405 nm)

Values represent the mean of triplicate determinations.

Peptides Amino acid sequences Antibodies
Monoclonal A5B7 Monoclonal A5D7 Monoclonal D12H5 Polyclonal

179                           208
 alpha 3(IV) 179-208   CHGRGTCNYYSNSYSFWLASLNPERMFRKP 0.97 1.61 0.20 >2
185                203
 alpha 3(IV) 185-203   CNYYSNSYSFWLASLNPER 1.54 1.61 0.15 >2
185                203
 alpha 1(IV) 185-203   CNYYANAYSFWLATIERSE 0.11 0.11 0.11 0.11
185                203
 alpha 2(IV) 185-203   CHYYANKYSFWLTTIPEQS 0.09 0.08 0.09 0.08
182                 200
 alpha 5(IV) 182-200   CNYYANSYSFWLATVDVDSD 0.09 0.10 0.09 0.09
185         196
 alpha 3(IV) 185-196   CNYYSNSYSFWL 0.64 1.0 0.11 1.20
194       203
 alpha 3(IV) 194-203   FWLASLNPER 0.21 0.24 0.09 0.34
        1             15
 alpha 3(IV) L5 clone 1-15a         GQDLDALFVNVLRSP
        182              200
 alpha 4(IV) 182-200a         CHFFANKYSFWLTTVPDLQ
 alpha 3(IV) 185-203b         185              203
  189 S right-arrow Aa         CVYYANSYSFWLASLNPER
  191 S right-arrow Aa         CVYYSNAYSFWLASLNPER

a Immunologic reactivities of these peptides were not tested by the ELISA.
b Synthetic peptides where serine in position 189 or 191 was replaced by alanine.

Production of Monoclonal Antibodies

Monoclonal antibodies to the synthetic peptide of the human NC1 domain of the alpha 3(IV) chain were prepared by the Cell Center of the University of Pennsylvania, using the purified synthetic human alpha 3(IV)179-208 peptide as immunogen. The purified alpha 3(IV)179-208 peptide was conjugated to hemocyanin and injected into mice (19). Monoclonal antibodies were produced by fusing the mouse lymphocytes and myeloma cells (SP2-0AG4 from ATCC and developed at University of Pennsylvania). Supernatants from the subclones were screened, and specific subclones were selected using the ELISA method described by Engvall and Perlmann (20).

Production of a rabbit polyclonal antibody to a synthetic peptide corresponding to residues 179-208 of the NC1 domain of the alpha 3(IV) chain was described elsewhere (15).

Characterizations of Monoclonal Antibodies and ELISA

The assay was performed essentially according to previously described methods of Engvall and Perlmann (20), using 96-well plastic plates (Dynatech Labs Inc., Chantilly, VA). All synthetic peptides were dissolved in 6 M GuHCl, pH 7.5, 4 °C, 0.5 mg/ml. The peptide solutions were diluted further in 50 mM sodium carbonate/bicarbonate buffer, pH 9.6. Various synthetic peptides were coated at concentrations of 250 ng/well and incubated overnight at 4 °C. Milk (5%) in PBS/Tween 20 was used as the blocking solution for 1 h. Supernatants from the selected subclones were added to wells and incubated for 1 h. Secondary antibody (anti-mouse IgG(H+L)-peroxidase, Boehringer Mannheim) was added to each well and incubated for 1 h. Finally, ABTS solution (Boehringer Mannheim) was added to each well. The plates were read at 405 nm in a Microplate Reader, EL340 (Bio-Tek Instruments). Monoclonal antibodies against specific residue sequences of alpha 3(IV)179-208 were selected.

Attachment Assay

Cell attachment was determined according to the method of Rao and Kefalides (21), with modification. The 24-well plastic plates were coated with the appropriate peptides at various amounts in 1.0 ml of coating buffer (0.1 M Tris-HCl buffer, pH 7.5). The peptides, dissolved in conditioned medium, were added to each well with coating buffer. The coating was terminated after incubating the plates for about 24 h at 4 °C, followed by washing twice with 1 ml of PBS. Wells were blocked by addition of 1.0 ml of attachment medium (Hanks' balanced saline solution containing 2% bovine serum albumin and 10 mM HEPES, pH 7.4) at room temperature for 1 h. Human melanoma cells near confluence were labeled with [35S]methionine (5 µCi/ml) in growth medium overnight. Cells, detached with 0.25% trypsin, EDTA solution and resuspended in attachment medium, were added to each well (2.5 × 105 cells/well) and incubated at 37 °C for 75 min in 5% CO2. The unattached cells were removed with three 1.0-ml washes in PBS. Attached cells were then lysed for 30 min by adding 0.5 ml of 1% Triton X-100 in PBS/well. The extracts were transferred to scintillation vials for counting, and the percent attachment was defined as (radioactivity extracted from attached cells)/(radioactivity in cells added to assay) × 100%. Results are expressed as percent of cells attached/well. Each attachment assay was run in triplicate.

Competition of Cell Binding Assay

For competition of the cell binding assay, 24-well plastic plates were coated with synthetic peptides as described above. The attachment assay was then performed as follows. Both monoclonal and polyclonal antibodies to peptide were tested for their ability to inhibit cell adhesion to the peptide. The antibodies were added to the wells at various dilutions and incubated for 2 h at room temperature before adding the [35S]methionine (5 µCi/ml)-labeled cell suspension (2.5 × 105 cells/well). Since the monoclonal antibody D12H5 did not react with any of the peptides tested, it was used as a negative control. The cells were incubated for 75 min at 37 °C. At end of the incubation, the plates were washed with PBS, the attached cells were solubilized with Triton X-100, and bound radioactivity was measured in a scintillation counter. The percent attachment was calculated as described above.

Cell Proliferation Assay

The determination of cell proliferation was done by counting cells in a coulter counter or by determining the [3H]thymidine incorporation as a measure of DNA synthesis, or by the MTT method. By using the MTT method, the activity of living cells via mitochondrial dehydrogenase activity was measured (MTT cell growth determination kit, Sigma). For cell counting and [3H]thymidine incorporation measurements, confluent cultures were dissociated and suspended in fresh tumor medium. 1 × 105 cells were added to wells of a 12-well plate and incubated for 3-4 h. Then, fresh medium containing one of the peptides was added to the wells. The medium was changed every 2 days. After a 5-day incubation with peptides, cells were either dissociated with 0.25% trypsin, EDTA and cell numbers counted in a coulter counter, or were labeled with [3H]thymidine (3 µCi/ml) overnight. Labeled cells were lysed with 1% Triton X-100 in PBS and radioactivity measured in a scintillation counter.

To test whether it is the peptide binding to the cells in the medium which induces the inhibitory effect on cell proliferation or whether it is the peptide adsorbed to the well surface causing strong cell adhesion which inhibits cell proliferation, cell-peptide interaction experiments were carried out. In one experiment, peptides were coated at varying amounts onto the wells of a 96-well plate, and 5 × 104 cells were added to each well. After a 5-day incubation, the MTT solution in an amount equal to 10% of the culture volume was added to each well, according to the kit procedure (Sigma). After a 4-h incubation at 37 °C, the culture medium was removed, and MTT solvent in an amount equal to the original culture volume was added to each well. The plates were read at 570 nm in a Microplate reader EL340 (Bio-Tek Instruments), and cell proliferation was determined. The cells in uncoated wells incubated with the medium containing the peptide were used as control. In another experiment, we tested whether the peptide from the medium adsorbed onto the well surface. Cells were removed by 0.1% sodium dodecyl sulfate after a 5-day incubation with the medium containing varying amounts of the alpha 3(IV)185-203 peptide. The presence of peptide attached to the well was detected by adding to the wells a polyclonal antibody to the alpha 3(IV) peptide at 1:250 dilution and incubating for 1 h at room temperature. The immunoreactivity of the alpha 3(IV) peptide was detected by ELISA as described above.


RESULTS

Characterizations of Monoclonal Antibodies

To characterize the monoclonal antibodies that recognize a functionally important domain within the peptides of the NC1 domain of the alpha 3(IV) chain of type IV collagen, we determined the ability of monoclonal antibodies to bind selectively to the synthetic peptides from the partial sequences of the alpha 3(IV) chain and from the comparable region of the different alpha  chains. As shown in Table I, the polyclonal antibody and monoclonal antibodies A5B7 and A5D7 reacted strongly only with the synthetic peptides from the alpha 3(IV) chain, i.e. alpha 3(IV)179-208 and alpha 3(IV)185-203, but did not react with the peptides from comparable regions of alpha 1(IV), alpha 2(IV), and alpha 5(IV) chains, even though they share considerable homology. To determine the critical sequence recognized by the monoclonal antibodies, the partial sequences of the alpha 3(IV) peptide, i.e. peptides comprising residues 185-196 and 194-203, were tested. Both the polyclonal antibody and the monoclonal antibodies A5B7 and A5D7 reacted strongly with the peptide alpha 3(IV)185-196, but they reacted very weakly with the peptide alpha 3(IV)194-203. The data indicate that the epitope recognized by the antibodies is contained within the region of residues 185-196 of alpha 3(IV) chain. It should be noted that the major difference between the alpha 3(IV)185-196 peptide and comparable peptides from other alpha  chains in this region is the sequence -SNS- (residues 189-191) within the alpha 3(IV) peptide which is not present in the others (Table I). It appears that this unique -SNS- sequence within the alpha 3(IV) peptide is very critical. Peptides where one or both serines are substituted (alpha 1, alpha 2, or alpha 5) failed to react with the antibodies (Table I).

It is interesting to note that the monoclonal antibody D12H5 reacted very weakly with all of the peptides, and it was therefore used as the control antibody in the competition of cell binding assay.

Cell Adhesion on Peptide Substrata

Synthetic peptides from the NC1 domain of alpha 3(IV) chain of the human type IV collagen were tested for their attachment-promoting activity on human melanoma cells. Fig. 1 shows that only alpha 3(IV) peptide promoted from 55-65% attachment of melanoma cells, whereas peptides from comparable regions of the alpha 1(IV), alpha 2(IV), and alpha 5(IV) chains did not. To determine whether a specific sequence was the active cell binding domain, two peptides of the alpha 3(IV) chain, comprising residues 185-196 (CNYYSNSYSFWL) and 194-203 (FWLASLNPER), were tested. Peptide alpha 3(IV)185-196 promoted adhesion of melanoma cells from 45 to 50%. In contrast, peptide alpha 3(IV)194-203 did not mediate cell adhesion beyond that of control. The property of cell adhesion is, therefore, dependent on the sequence of residues 185-196 within the alpha 3(IV)185-203 peptide.


Fig. 1. Attachment of human melanoma cells, WM9 and WM136 1A. Each well of 24-well plates was coated with synthetic peptide alpha 1(IV)185-203, alpha 2(IV)185-203, alpha 3(IV)185-203, alpha 5(IV)182-200, and partial sequences of alpha 3(IV)185-203, alpha 3(IV)185-196, and alpha 3(IV)194-203 (2.5 µg/well) overnight. 2.5 × 105 [35S]methionine-labeled cells were added to each well, and attached cells were measured as described under "Materials and Methods." black-square, control; , alpha 1(IV)185-203; , alpha 2(IV)185-203; , alpha 5(IV)182-200; square , alpha 3(IV)185-203; , alpha 3(IV)185-196; , alpha 3(IV)194-203. Error bars represent S.D. from the mean.
[View Larger Version of this Image (31K GIF file)]

Effect of Peptides on Cell Proliferation

Table II shows the effects of synthetic peptides on tumor cell proliferation. Proliferation of melanoma cells was inhibited from 20 to 42% when cells were grown in medium containing peptide alpha 3(IV) 185-203 (5 µg/ml). This inhibition was reproducible in different melanoma cell lines, including WM9, WM164, WM136 1A, HT-144, and UACC-903, and in two non-melanoma tumor cell lines (HT-1080 and MG-63). Replication of normal fibroblasts was unaffected by the alpha 3(IV) peptides. On the other hand, synthetic peptides from comparable regions of the alpha 1(IV), alpha 2(IV), and alpha 4(IV) chains did not show significant inhibition of replication (Table II). The effect of peptides representing partial sequences of alpha 3(IV)185-203 was also assessed in these experiments. Fig. 2a shows that the inhibitory effect was significant only in the cells treated with peptides alpha 3(IV)185-203 and alpha 3(IV)185-196 (about 44% inhibition). The proliferation of melanoma cells treated with peptide alpha 3(IV)194-203, which lacks the -SNS- triplet, was not significantly affected.

Table II. Effect of peptides from the NC1 domain of type IV collagen on cell proliferation

Cells (2.5 ×104/2-cm2 well) were incubated with various peptides and labeled with [3H]thymidine as described under "Materials and Methods." ND, not determined.

  [3H]Thymidine incorporation
Control  alpha 1(185-203)  alpha 2(185-203)  alpha 3(185-203)  alpha 4(182-200)

cpm asof control
Melanoma cells
  HT-144 100  ± 14 87.9  ± 8 87.2  ± 11 71.9  ± 3 95.9  ± 9
  UACC-903 100  ± 7 102.3  ± 5 114.2  ± 10 80.0  ± 12 103.5  ± 7
  WM9 100  ± 10 106.7  ± 5.3 94.5  ± 11.5 62  ± 8.6 114.9  ± 6
  WM164 100  ± 4.5 ND ND 68.7  ± 4 ND
  WM136 1A 100  ± 7.6 ND ND 57.5  ± 6 ND
Fibrosarcoma cells
  HT-1080 100  ± 11 109.1  ± 11 113.7  ± 10 72.0  ± 17 113.0  ± 9
Osteosarcoma cells
  MG-63 100  ± 8 107.7  ± 6 107.7  ± 7 69.0  ± 10 103.6  ± 6
Normal fibroblasts
  Dermal 100  ± 12 114.2  ± 19 114.9  ± 19 129.3  ± 7 143.3  ± 6
  MRC-5 100  ± 14 104.2  ± 17 102.9  ± 8 102.7  ± 4 107.4  ± 3


Fig. 2. Effects of peptides on melanoma cell proliferation. Panel a, WM9 cells were treated with various partial sequences of synthetic peptide alpha 3(IV)185-203, i.e. alpha 3(IV)185-196 and alpha 3(IV)194-203 (5 µg/ml). black-square, control; , alpha 3(IV)185-203; , alpha 3(IV)185-196; , alpha 3(IV)194-203. Cell numbers were counted as described under "Materials and Methods" and expressed as percent of control. Panel b, to test the effect of cell attachment to substrate containing the peptide, WM9 cells were plated onto wells coated with various amounts of the alpha 3(IV)185-203 peptide and incubated for 5 days. Cell proliferation was measured by the MTT method. black-square, control; , 1 µg; , 2.5 µg; , 5 µg; square , 10 µg; , 25 µg of peptide-coated cells. Panel c, to determine whether the peptide adsorbed to well surface from the medium during the incubation, WM9 and WM164 cells were treated with alpha 3(IV)185-203 peptide for 5 days. After that, cells were removed with 0.1% sodium dodecyl sulfate, and any adsorbed peptide was detected with the polyclonal antibody using ELISA as described under "Materials and Methods." black-square, control (without peptide); , 1 µg; , 2.5 µg; , 5 µg of peptide-treated cells. Without cells means that wells were incubated with medium containing varying amounts of the peptide in the absence of cells. After removal of the medium any adsorbed peptide was measured by ELISA. Panel d, to assess whether cell proliferation could be resumed, WM9 cells were first treated with alpha 3(IV)185-203 (5 µg/ml) for 5 days (Group 1). After removal of the peptide, cells were incubated with peptide-free medium for an additional 6 days (Group 2). [3H]Thymidine uptake by cells without peptide treatment was taken as control (100%). [3H]Thymidine uptake by cells treated with peptide is presented as the percentage of control. black-square, control; , experimental. Error bars represent S.D. from the mean.
[View Larger Version of this Image (60K GIF file)]

There is the possibility that significant amounts of peptide moved from the medium and became adsorbed to the well surface, causing firm cell adhesion and thereby decreasing cell proliferation. To exclude this possibility, melanoma cells were plated onto wells, coated with the alpha 3(IV)185-203 peptide at various concentrations, for 5 days. Although the alpha 3(IV) peptide induced melanoma cell adhesion, there was only a minimal decrease in cell proliferation (10-15%) even at concentrations 5 × (25 µg) that which gives maximum inhibition of cell proliferation (Fig. 2b). However, when the alpha 3(IV) peptide was placed in the medium, the decrease in proliferation was significantly greater (40%) (Fig. 2a). Additional experiments also showed that after a 5-day peptide treatment, the majority of the peptide did not make its way into the substrate and was bound to the cell surface (Fig. 2c). The slight increase in peptide content on the well surface can be accounted for by the type IV collagen synthesized by the cells during incubation. These data suggest that the cell-peptide contact in the medium is responsible for the observed inhibition of cell proliferation. To assess whether cell proliferation resumed after removal of the peptide in the medium, at the end of the 5-day period the peptide-containing medium was removed, and cells were incubated in peptide-free medium for an additional 6 days. At the end of this period, cell proliferation was back to control levels (Fig. 2d).

Prevention of Cell Adhesion and Inhibition of Proliferation by Antibodies

To test the specificity of the cell binding domain of the peptide alpha 3(IV)185-203, both monoclonal and polyclonal antibodies against this sequence were used to block peptide-mediated cell adhesion and inhibition of cell proliferation. WM9 melanoma cell adhesion on surfaces coated with peptide alpha 3(IV)185-203 (2.5 µg/well) was monitored in the presence of anti-peptide antibodies. Melanoma cell adhesion was inhibited to an extent of 53-60% by the polyclonal antibody and by the monoclonal antibody A5D7. No significant inhibition of cell adhesion was observed in the presence of a control nonreactive monoclonal antibody D12H5 (Fig. 3a). The effect of the alpha 3(IV) peptide on cell proliferation, on the other hand, was also prevented by the antibodies. When the alpha 3(IV) peptide was treated with antibody before adding to the medium, its inhibitory effect on cell proliferation was decreased significantly (Fig. 3b). It is suggested that a functional domain in the alpha 3(IV)185-203 peptide, recognized by the monoclonal antibody A5D7, is responsible for the activities of promotion of cell adhesion and inhibition of cell proliferation.


Fig. 3. Panel a, effect of anti-peptide antibodies on attachment of WM9 melanoma cells to peptides. Each well was coated with synthetic peptide alpha 3(IV)185-203 (2.5 µg/well) overnight. Monoclonal or polyclonal antibodies to the peptide were added to the wells as described under "Materials and Methods." Cells were seeded on the polyclonal antibody-treated (1:50 dilution) or on the monoclonal antibody A5D7-treated (undiluted) substrates (columns 2 and 3). Cells were also seeded on the peptide-containing substrate without antibody treatment as control (column 1). Monoclonal antibody D12H5 (undiluted), which reacted very weakly with all of the peptides, was also used as control antibody (column 4). The inhibitory effect of the monoclonal and polyclonal antibodies on the biological properties of the peptide is evident. Panel b, effects of anti-peptide antibodies on melanoma cell proliferation. The synthetic peptide alpha 3(IV)185-203 was incubated with antibodies before adding to the medium. Monoclonal antibodies A5D7 and D12H5 were used at a 1:1 dilution. The polyclonal antibody was in a 1:50 dilution. After that, the antibody-treated peptides (5 µg/ml) were added to the medium, and cell proliferation was determined by the MTT method. black-square, control; , alpha 3(IV)185-203; , alpha 3(IV)185-203 + A5D7; , alpha 3(IV)185-203 + polyclonal Ab; square , alpha 3(IV)185-203 + D12H5. Error bars represent S.D. from the mean.
[View Larger Version of this Image (23K GIF file)]

Identification of the Functional Domain in alpha 3(IV) Peptide

The current studies indicate that the sequence of residues 185-196 of the NC1 domain of the alpha 3(IV) chain contains the functional domain that is responsible for the cell adhesion and the inhibitory effect on cell proliferation. The unique triplet -SNS- within the above sequence appears to represent such a functional domain. To confirm this, we replaced serine with alanine in either position 189 or 191 of the alpha 3(IV) peptide (Table I, modified synthetic peptides) and tested the cell adhesion-promoting activity of the modified alpha 3(IV) peptides on two melanoma cell lines. Fig. 4a shows the results of these experiments. Serine substitution resulted in significantly reduced adhesion. Adhesion fell from 72% with the peptide containing the -SNS- sequence to 44 and 28% with peptides containing the -ANS- and -SNA- sequence, respectively, for W9 cells. With W164 cells, the values fell from 60 to 24 and 20%, respectively. The same modified alpha 3(IV)185-203 peptides were also used to test the effect on melanoma cell proliferation. When melanoma cells were incubated with the modified alpha 3(IV) peptides, in both instances, i.e. with -SNA- or -ANS- sequence, cell proliferation was not inhibited to any appreciable extent compared with the -SNS- sequence (94 and 88.5% of control, respectively) (Fig. 4b). It is suggested that the active domain, which mediates melanoma cell adhesion and inhibits cell proliferation, is the triplet sequence of -SNS-. Replacement of serine with alanine in either position 189 or 191 abolishes both activities of the peptide.


Fig. 4. The modified alpha 3(IV)185-203 peptides, where the serine in positions 189 or 191 was replaced by alanine, i.e. -ANS- and -SNA-, were used to identify the cell binding domain in alpha 3(IV) peptide. Panel a, attachment of melanoma cells to the substitute peptides of alpha 3(IV)183-203 (2.5 µg/well) where the serine was replaced by alanine. 2.5 × 105 [35S]methionine-labeled cells were added to each well, and attached cells were measured as described under "Materials and Methods." black-square, control; , alpha 3(IV)185-203-SNS (unsubstituted); , alpha 3(IV) 185-203-ANS; , alpha 3(IV) 185-203-SNA. Panel b, effects of the modified alpha 3(IV) peptide on melanoma cell proliferation. The modified alpha 3(IV) peptides (5 µg/ml) were added to the medium, and cell proliferation was monitored by the MTT method. black-square, control; , alpha 3(IV)-SNS; , alpha 3(IV)-SNA; , alpha 3(IV)-ANS. Error bars represent S.D. from the mean.
[View Larger Version of this Image (33K GIF file)]


DISCUSSION

Our previous studies have shown that the peptide a3(IV)185-203 prevents activation of human PMN, and the unique sequence -SNS- is the domain required for the inhibition of O2- production and enzyme release by these cells (15). Because melanoma cells are in direct contact with basement membranes during tumor cell invasion and metastasis, we elected to assess the in vitro influence of type IV collagen peptides on the attachment and the proliferation of human melanoma cells. In this study, several synthetic peptides from the NC1 domain of the alpha  chains of type IV collagen were tested. Residues 185-203 of the alpha 3(IV) chain comprise the only sequence that significantly increases adhesion of melanoma cells and inhibits their proliferation. The peptide-mediated melanoma cell adhesion can be prevented by specific polyclonal and monoclonal antibodies. It is of interest to note that the monoclonal antibody that recognized the sequence 185-196 of the alpha 3(IV) peptide also prevented the inhibition of melanoma cell proliferation. It would appear that the cell adhesion-promoting activity and the inhibitory effect of the peptide on cell proliferation may be two functions that are intimately related. To rule out the possibility that strong attachment of melanoma cells to the peptide in the substrata was responsible for the effect of the alpha 3(IV) peptide on melanoma cell proliferation, we carried out cell-peptide interaction experiments. The data clearly showed that it was the binding of the peptide to the apical region of the cells rather than to the basal region which was responsible for inhibition of cell proliferation (Fig. 2, b and c). We also observed that exposure of the cells to the peptide caused aggregation and clumping (data not shown). It would appear that it is the interaction of the cell surface with the soluble peptide which is necessary for inhibition of cell proliferation to occur.

In the current studies, it appears that the sequence -SNS- of the alpha 3(IV)185-203 peptide is an absolute requirement for both cell adhesion and inhibition of cell proliferation. Although this region is highly conserved in the NC1 domain of all alpha  chains of type IV collagen, the sequence -SNS- (residues 189-191) is unique to the alpha 3(IV) chain. Both monoclonal and polyclonal antibodies specifically recognized the region of the peptide alpha 3(IV)185-196 which contains the sequence -SNS-. The antibodies efficiently inhibited the cell binding to the substrate, confirming the specificity of this interaction. Substitution of either serine in the sequence -SNS- abolished the cell adhesion activity of the peptide, suggesting that the sequence -SNS- is a multifunctional cell binding domain that mediates cell adhesion and inhibits cell proliferation.

Unpublished studies in our laboratory demonstrate that this peptide inhibits proliferation not only of melanoma cells but of other epithelial tumors cell and concomitantly increases intracellular cAMP. It was strongly suggested that a mechanism involving a signal transduction pathway may play a role in the cell adhesion-promoting activity and in inhibition of cell proliferation by the alpha 3(IV) peptide. The same peptide causes an inhibition of PMN activation through a rise in intracellular cAMP (15). An increase in cAMP is associated with an inhibition of O2- production as well as secretion of proteinases and lactoferrin (15, 22). The increase of cAMP in PMN (15) and in melanoma cells induced by the peptide can be inhibited by pertussis toxin, suggesting involvement of G proteins (23). A detailed study of the events in the signal transduction pathway triggered by the alpha 3(IV) peptide is the subject of a manuscript under consideration. The direct effect of the alpha 3(IV) peptide on melanoma cell adhesion and proliferation raises the question of whether a specific receptor for this peptide is involved. Studies are under way to isolate and characterize the putative receptor.

Tumor cell proliferation and metastasis are complex processes involving numerous tumor cell-extracellular matrix interactions that at present are incompletely understood. The interaction of tumor cells with basement membrane is the first step in a multifunctional process (24). It is also unknown what specific role the NC1 domain of the alpha 3(IV) chain may play in vivo in the maintenance of the normal phenotype of overlying epithelial cells or of transmigrating tumor cells. Secondary structure studies have shown that the sequence, which contains the triplet -SNS- of the alpha 3(IV) chain, occurs within one of the two beta -turns occupied by the alpha 3(IV)185-203 peptide sequence (14). It is hypothesized that the NC1 domain of the alpha 3(IV) chain must be exposed within the basement membrane in a way that this region of the chain is on the outside and promotes contact with the transmigrating PMN or tumor cells or with overlying epithelial cells in a given tissue.

In this report we have demonstrated that a peptide from the NC1 domain of the alpha 3(IV) chain of type IV collagen, comprising residues 185-203, contains a multifunctional domain that promotes cell adhesion and inhibits proliferation of melanoma cells. An absolute requirement for these biological activities is the presence of a triplet -SNS- within this peptide. Studies are currently under way to elucidate the steps in the transduction pathway involved in these biological activities and to isolate and characterize the putative receptor that recognizes the above peptide.


FOOTNOTES

*   This work was supported in part by National Institutes of Health Grants HL-29492, AR-20553, and AR-07490, by the Ligue Contre le Cancer, and by the NATO Collaborative Research Grants Program. This work was also supported in part by the Medical Center Protein Chemistry Facility of the University of Pennsylvania.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
   To whom correspondence should be addressed: CTRI, University of Pennsylvania, The University City Science Center, 3624 Market St., Philadelphia, PA 19104. Tel.: 215-387-2255; Fax: 215-382-1749.
1   The abbreviations used are: PMN, polymorphonuclear leukocytes; ELISA, enzyme-linked immunosorbent assay; PBS, phosphate-buffered saline; MTT, 3-(4,5-dimethyl thiazol-2-yl)-2,5-diphenyl tetrazolium bromide.

REFERENCES

  1. Butkowski, R. J., Wieslander, J., Wisdom, B. J., Barr, J. F., Noelken, M. E., and Hudson, B. G. (1985) J. Biol. Chem. 260, 3739-3747 [Abstract/Free Full Text]
  2. Saus, J., Wieslander, J., Langeveld, J. P. M., Quinones, S., and Hudson, B. G. (1988) J. Biol. Chem. 263, 13374-13380 [Abstract/Free Full Text]
  3. Gunwar, S., Saus, J., Noelken, M. E., and Hudson, B. G. (1990) J. Biol. Chem. 265, 5466-5469 [Abstract/Free Full Text]
  4. Hudson, B. G., Reeders, S. T., and Tryggvason, K. (1993) J. Biol. Chem. 268, 26033-26036 [Free Full Text]
  5. Leinonen, A., Mariyana, M., Mochizuki, T., Tryggvason, K., and Reeders, S. T. (1994) J. Biol. Chem. 269, 26172-26177 [Abstract/Free Full Text]
  6. Zhou, J., Ding, M., Zhao, Z., and Reeders, S. T. (1994) J. Biol. Chem. 269, 13193-13199 [Abstract/Free Full Text]
  7. Charonis, A. S., Tsilibary, E. C., Yurchenco, P. D., and Furthmayr, H. (1985) J. Cell Biol. 100, 1848-1853 [Abstract/Free Full Text]
  8. Laurie, G. W., Bing, J. T., Kleinman, H. K., Hassell, J. R., Aumailley, M., Martin, G. R., and Edelman, R. J. (1986) J. Mol. Biol. 189, 205-216 [CrossRef][Medline] [Order article via Infotrieve]
  9. Chelberg, M. K., Tsilibary, E. C., Hauser, A. J., and McCarthy, J. B. (1989) Cancer Res. 49, 4796-4802 [Abstract/Free Full Text]
  10. Feng, L., Xia, Y., and Wilson, C. B. (1994) J. Biol. Chem. 269, 2342-2348 [Abstract/Free Full Text]
  11. Ries, A., Engel, J., Lustig, A., and Kuhn, K. (1995) J. Biol. Chem. 270, 23790-23794 [Abstract/Free Full Text]
  12. Chelberg, M. K., McCarthy, J. B., Skubitz, A. P. N., Furcht, L. T., and Tsilibary, E. C. (1990) J. Cell Biol. 111, 261-270 [Abstract/Free Full Text]
  13. Tsilibary, E. C., Reger, L. A., Vogel, A. M., Koliakos, G. G., Anderson, S. S., Charonis, A. S., Alegre, J. N., and Furcht, L. T. (1990) J. Cell Biol. 111, 1583-1591 [Abstract/Free Full Text]
  14. Kefalides, N. A., Ohno, N., Wilson, C. B., Fillit, H., Zabriski, J., and Rosenbloom, J. (1993) Kidney Int. 43, 94-100 [Medline] [Order article via Infotrieve]
  15. Monboisse, J. C., Garnotel, R., Bellon, G., Ohno, N., Perreau, C., Borel, J. P., and Kefalides, N. A. (1994) J. Biol. Chem. 269, 25475-25482 [Abstract/Free Full Text]
  16. Herlyn, M., Kath, R., Williams, N., Valyi-Nagy, I., and Rodeck, U. (1989) Adv. Cancer Res. 54, 213-234
  17. Herlyn, M. (1990) Cancer Metastasis Rev. 9, 101-112 [CrossRef][Medline] [Order article via Infotrieve]
  18. Barany, G., and Merrifield, R. B. (1980) in The Peptides (Gross, E., and Meinhofer, J., eds), Vol. 12, pp. 1-284, Academic Press, New York
  19. Laune, J. M. (1986) Methods Enzymol. 121, 183-192 [Medline] [Order article via Infotrieve]
  20. Engvall, E., and Perlmann, P. (1972) J. Immunol. 109, 129-135 [Abstract/Free Full Text]
  21. Rao, C. N., and Kefalides, N. A. (1990) Biochemistry 29, 6769-6777
  22. Tyagi, S. R., Olson, S. C., Burnham, D. N., and Lambeth, J. D. (1991) J. Biol. Chem. 266, 3498-3504 [Abstract/Free Full Text]
  23. Shahan, T. A., Han, J., Edwards, J. A., Pasco, S., Monboisse, J. P., Borel, J. P., and Kefalides, N. A. (1996) Mol. Biol. Cell 7, 415
  24. Liotta, L. A., Steeg, P. S., and Stetler-Stevenson, W. G. (1991) Cell 64, 327-336 [CrossRef][Medline] [Order article via Infotrieve]

©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Cancer Res.Home page
T. Kawaguchi, Y. Yamashita, M. Kanamori, R. Endersby, K. S. Bankiewicz, S. J. Baker, G. Bergers, and R. O. Pieper
The PTEN/Akt Pathway Dictates the Direct {alpha}V{beta}3-Dependent Growth-Inhibitory Action of an Active Fragment of Tumstatin in Glioma Cells In vitro and In vivo
Cancer Res., December 1, 2006; 66(23): 11331 - 11340.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. M. Borza, A. Pozzi, D.-B. Borza, V. Pedchenko, T. Hellmark, B. G. Hudson, and R. Zent
Integrin {alpha}3beta1, a Novel Receptor for {alpha}3(IV) Noncollagenous Domain and a Trans-dominant Inhibitor for Integrin {alpha}vbeta3
J. Biol. Chem., July 28, 2006; 281(30): 20932 - 20939.
[Abstract] [Full Text] [PDF]


Home page
J. Am. Soc. Nephrol.Home page
R. Zent and A. Pozzi
Antiangiogenic Therapy in Diabetic Nephropathy
J. Am. Soc. Nephrol., February 1, 2006; 17(2): 325 - 327.
[Full Text] [PDF]


Home page
Cancer Res.Home page
P. Nyberg, L. Xie, and R. Kalluri
Endogenous Inhibitors of Angiogenesis
Cancer Res., May 15, 2005; 65(10): 3967 - 3979.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Pathol.Home page
J. M. Roth, A. Akalu, A. Zelmanovich, D. Policarpio, B. Ng, S. MacDonald, S. Formenti, L. Liebes, and P. C. Brooks
Recombinant {alpha}2(IV)NC1 Domain Inhibits Tumor Cell-Extracellular Matrix Interactions, Induces Cellular Senescence, and Inhibits Tumor Growth in Vivo
Am. J. Pathol., March 1, 2005; 166(3): 901 - 911.
[Abstract] [Full Text] [PDF]


Home page
Cold Spring Harb Symp Quant BiolHome page
M.A. GRANT and R. KALLUR
Structural Basis for the Functions of Endogenous Angiogenesis Inhibitors
Cold Spring Harb Symp Quant Biol, January 1, 2005; 70(0): 399 - 417.
[Abstract] [PDF]


Home page
Ann. Thorac. Surg.Home page
N. K. Mukhopadhyay, D. Gilchrist, G. J. Gordon, C.-J. Chen, R. Bueno, M. L. Lu, R. Salgia, D. J. Sugarbaker, and M. T. Jaklitsch
Integrin dependent protein tyrosine phosphorylation is a key regulatory event in collagen IV mediated adhesion and proliferation of human lung tumor cell line, Calu-1
Ann. Thorac. Surg., August 1, 2004; 78(2): 450 - 457.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
V. Trochon-Joseph, D. Martel-Renoir, L. M. Mir, A. Thomaidis, P. Opolon, E. Connault, H. Li, C. Grenet, F. Fauvel-Lafeve, J. Soria, et al.
Evidence of Antiangiogenic and Antimetastatic Activities of the Recombinant Disintegrin Domain of Metargidin
Cancer Res., March 15, 2004; 64(6): 2062 - 2069.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
V. Pedchenko, R. Zent, and B. G. Hudson
{alpha}v{beta}3 and {alpha}v{beta}5 Integrins Bind Both the Proximal RGD Site and Non-RGD Motifs within Noncollagenous (NC1) Domain of the {alpha}3 Chain of Type IV Collagen: IMPLICATION FOR THE MECHANISM OF ENDOTHELIAL CELL ADHESION
J. Biol. Chem., January 23, 2004; 279(4): 2772 - 2780.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
N. Floquet, S. Pasco, L. Ramont, P. Derreumaux, J. Y. Laronze, J. M. Nuzillard, F. X. Maquart, A. J. P. Alix, and J. C. Monboisse
The Antitumor Properties of the {alpha}3(IV)-(185-203) Peptide from the NC1 Domain of Type IV Collagen (Tumstatin) Are Conformation-dependent
J. Biol. Chem., January 16, 2004; 279(3): 2091 - 2100.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
N. Ortega and Z. Werb
New functional roles for non-collagenous domains of basement membrane collagens
J. Cell Sci., November 15, 2002; 115(22): 4201 - 4214.
[Abstract] [Full Text] [PDF]


Home page
Cold Spring Harb Symp Quant BiolHome page
R. KALLURI
Discovery of Type IV Collagen Non-collagenous Domains as Novel Integrin Ligands and Endogenous Inhibitors of Angiogenesis
Cold Spring Harb Symp Quant Biol, January 1, 2002; 67(0): 255 - 266.
[Abstract] [PDF]


Home page
J. Histochem. Cytochem.Home page
C. Catusse, M. Polette, C. Coraux, H. Burlet, and P. Birembaut
Modified Basement Membrane Composition During Bronchopulmonary Tumor Progression
J. Histochem. Cytochem., May 1, 2000; 48(5): 663 - 670.
[Abstract] [Full Text]


Home page
J. Biol. Chem.Home page
T. A. Shahan, A. Fawzi, G. Bellon, J.-C. Monboisse, and N. A. Kefalides
Regulation of Tumor Cell Chemotaxis by Type IV Collagen Is Mediated by a Ca2+-dependent Mechanism Requiring CD47 and the Integrin alpha Vbeta 3
J. Biol. Chem., February 18, 2000; 275(7): 4796 - 4802.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
S. Pasco, J. Han, P. Gillery, G. Bellon, F.-X. Maquart, J. P. Borel, N. A. Kefalides, and J. C. Monboisse
A Specific Sequence of the Noncollagenous Domain of the {{alpha}}3(IV) Chain of Type IV Collagen Inhibits Expression and Activation of Matrix Metalloproteinases by Tumor Cells
Cancer Res., January 1, 2000; 60(2): 467 - 473.
[Abstract] [Full Text]


Home page
Cancer Res.Home page
T. A. Shahan, Z. Ziaie, S. Pasco, A. Fawzi, G. Bellon, J.-C. Monboisse, and N. A. Kefalides
Identification of CD47/Integrin-associated Protein and {{alpha}}v{beta}3 as Two Receptors for the {{alpha}}3(IV) Chain of Type IV Collagen on Tumor Cells
Cancer Res., September 1, 1999; 59(18): 4584 - 4590.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Maeshima, P. C. Colorado, and R. Kalluri
Two RGD-independent alpha vbeta 3 Integrin Binding Sites on Tumstatin Regulate Distinct Anti-tumor Properties
J. Biol. Chem., July 28, 2000; 275(31): 23745 - 23750.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Maeshima, P. C. Colorado, A. Torre, K. A. Holthaus, J. A. Grunkemeyer, M. B. Ericksen, H. Hopfer, Y. Xiao, I. E. Stillman, and R. Kalluri
Distinct Antitumor Properties of a Type IV Collagen Domain Derived from Basement Membrane
J. Biol. Chem., July 7, 2000; 275(28): 21340 - 21348.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Pasco, J.-C. Monboisse, and N. Kieffer
The alpha 3(IV)185-206 Peptide from Noncollagenous Domain 1 of Type IV Collagen Interacts with a Novel Binding Site on the beta 3 Subunit of Integrin alpha vbeta 3 and Stimulates Focal Adhesion Kinase and Phosphatidylinositol 3-Kinase Phosphorylation
J. Biol. Chem., October 13, 2000; 275(42): 32999 - 33007.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Maeshima, M. Manfredi, C. Reimer, K. A. Holthaus, H. Hopfer, B. R. Chandamuri, S. Kharbanda, and R. Kalluri
Identification of the Anti-angiogenic Site within Vascular Basement Membrane-derived Tumstatin
J. Biol. Chem., April 27, 2001; 276(18): 15240 - 15248.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Maeshima, U. L. Yerramalla, M. Dhanabal, K. A. Holthaus, S. Barbashov, S. Kharbanda, C. Reimer, M. Manfredi, W. M. Dickerson, and R. Kalluri
Extracellular Matrix-derived Peptide Binds to alpha vbeta 3 Integrin and Inhibits Angiogenesis
J. Biol. Chem., August 17, 2001; 276(34): 31959 - 31968.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Han, J.
Right arrow Articles by Kefalides, N. A.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Han, J.
Right arrow Articles by Kefalides, N. A.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1997 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement