JBC INTERFERin siRNA transfection reagent

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Shapiro, R. E.
Right arrow Articles by Schnaar, R. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Shapiro, R. E.
Right arrow Articles by Schnaar, R. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 272, Number 48, Issue of November 28, 1997 pp. 30380-30386

Identification of a Ganglioside Recognition Domain of Tetanus Toxin Using a Novel Ganglioside Photoaffinity Ligand*

(Received for publication, May 5, 1997, and in revised form, September 22, 1997)

Robert E. Shapiro Dagger §, Chelsea D. Specht , Brian E. Collins par , Amina S. Woods , Robert J. Cotter and Ronald L. Schnaar **

From the Departments of Dagger  Neurology,  Pharmacology and Molecular Sciences, and ** Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205

ABSTRACT
INTRODUCTION
MATERIALS AND METHODS
RESULTS
DISCUSSION
FOOTNOTES
ACKNOWLEDGEMENTS
REFERENCES


ABSTRACT

Tetanus toxin entry into vertebrate motorneurons may involve binding of neuronal surface gangliosides containing the "1b" substructure (a NeuAcalpha 2,8NeuAc group on an internal galactose residue). The domains of tetanus toxin involved in ganglioside binding are known to reside within the carboxyl-terminal half of the toxin's heavy chain ("C fragment"). We developed a novel photoaffinity reagent based upon the structure of the 1b ganglioside GD1b (125I-azido-GD1b) to define the ganglioside-binding domains of tetanus toxin. Using this ligand, we observed radiolabeling of tetanus toxin C fragment which could be specifically inhibited by a ganglioside of the 1b series (GT1b), but not by a non-1b series ganglioside (GM3). When tetanus toxin C fragment was proteolyzed with clostripain, whether before or after reaction with 125I-azido-GD1b, a radiolabeled band was observed by SDS-polyacrylamide gel electrophoresis autoradiography, which was selectively inhibited by GT1b. Protein sequencing of proteolyzed tetanus toxin C fragment co-migrating with that band revealed the carboxyl-terminal 34 amino acid residues of tetanus toxin. Matrix-assisted laser desorption/ionization mass spectrometry of a photoaffinity labeled synthetic polypeptide representing the 34-amino acid domain revealed modification at a single residue (His1293). We propose that this domain of tetanus toxin is sufficient for ganglioside binding.


INTRODUCTION

The major Clostridial neurotoxins, botulinum and tetanus toxins, are a family of homologous proteins with selective toxicity for vertebrate motorneurons (1). Their neurotropism is a long studied phenomenon (for an excellent historical review and primary historical references, see Niemann (1)). These toxins are believed to gain neural entry by recognition of specific binding sites on motorneuronal axonal processes, followed by endocytosis, intracellular transport, and targeting of the toxins to sites of action. The motorneuron membrane structures responsible for reception of Clostridial toxins have not been definitively established. However, a wealth of data implicate cell surface glycolipids as toxin-binding sites (2). Early studies demonstrated that a crude preparation of mixed brain gangliosides, glycosphingolipids containing anionic sialic acid (NeuAc) carbohydrate residues, could "fix" tetanus toxin in vitro (3, 4). Subsequently, purified gangliosides containing the "1b" substructure (a NeuAcalpha 2,8NeuAc group on an internal galactose residue) were shown to directly support toxin binding, and to inhibit toxin binding to brain membranes (5-7). Ganglioside GT1b1 has so far demonstrated the highest affinity for tetanus toxin (5, 7) and most of the botulinum toxin serotypes (8-10), although ganglioside species with higher affinities may exist.

Considerable progress has been made in defining the toxin peptide sequences necessary and sufficient for both cell membrane and ganglioside binding. The high degree of amino acid sequence homology across the 7 cloned Clostridial toxins (11-17), combined with the conservation of ganglioside binding among these proteins (9), suggests that a conserved amino acid motif may define a common carbohydrate recognition site responsible for toxin-ganglioside binding. For three toxins (tetanus toxin (18) and botulinum toxin serotypes A (19, 20) and E (21)), ganglioside binding is supported by the isolated carboxyl-terminal half (approx 50 kDa) of the respective heavy chains. This region of tetanus toxin is commonly termed the "C fragment" and roughly comprises amino acids 864-1315 (1).

Recently, in a highly informative study, Halpern and Loftus (22) synthesized various peptide fragments near the carboxyl terminus of tetanus toxin and measured their binding to immobilized GT1b ganglioside and neurons at physiological pH and ionic strength. Their data indicated that ganglioside binding is mediated by the carboxyl-terminal portion of the tetanus toxin C fragment, although contributions of protein secondary and tertiary structure to binding (e.g. interactions of non-contiguous polypeptide sequences) may be significant.

To extend this analysis, we developed a novel ganglioside-based photoaffinity ligand to identify polypeptide domains of tetanus toxin involved in binding to 1b series gangliosides. A radioiodinated aryl azide derivative of GD1b ganglioside (125I-azido-GD1b) was synthesized, incubated with tetanus toxin C fragment in solution, and then the reaction was photolyzed, thereby covalently fixing the ligand at the toxin's presumptive ganglioside-binding site(s). The photoaffinity-labeled tetanus toxin C fragment was then enzymatically proteolyzed and the resultant radiolabeled peptides purified and sequenced. An advantage of azido-GD1b photoaffinity labeling is that ganglioside binding may be performed prior to toxin fragmentation, while the protein is in its native conformation. Using this technique we identify the 34-amino acid peptide at the carboxyl terminus of tetanus toxin as sufficient for ganglioside binding, and demonstrate specific photoaffinity labeling at His1293.


MATERIALS AND METHODS

Scheme for 125I-Azido-GD1b Synthesis

A GD1b ganglioside photoaffinity ligand was designed (Fig. 1) to minimize disturbance of the ganglioside substructures most responsible for Clostridial toxin binding, yet place a photoactivatable aryl azide in close proximity to the toxin binding determinant. The glycerol side chains (carbons 7-9) of terminal sialic acids on 1b gangliosides are not essential for Clostridial toxin binding, yet are positioned near the carboxyl groups of the sialic acids, which are necessary for such binding (19). Accordingly, an azido-GD1b ligand was synthesized by linking a commercially available aryl azide photoreagent to carbon 7 of the terminal sialic acid of GD1b. The aryl azide can be readily radioiodinated, and is spaced from the ganglioside by a short disulfide-containing linker arm, making it cleavable. This design provides for limited mobility to the aryl azide with respect to the ganglioside determinants necessary for toxin binding, as well as a simple means of cleaving the ligand, following photolysis, to yield photoaffinity labeled toxin free of the ganglioside structure.


Fig. 1. Synthesis of azido-GD1b. The terminal sialic acid of GD1b is shown, where "R" designates the alpha 2,8-linkage to the rest of the ganglioside. GD1b was treated with periodic acid under conditions which selectively oxidize the glycerol side chain of the terminal sialic acid (Reaction 1), resulting in a unique aldehyde at carbon 7. Reductive amination with ammonium acetate and sodium cyanoborohydride (Reaction 2) generated a unique primary amine at carbon 7. The 7-amine derivative was subsequently treated with a commercial photoaffinity intermediate sulfosuccinimidyl 2-(p-azidosalicylamido)ethyl-1,3'-dithiopropionate (Reaction 3) to generate the desired product, which was amenable to radioiodination vicinal to the hydroxyl group on the phenyl ring.

[View Larger Version of this Image (10K GIF file)]


GD1b Oxidation

GD1b (10 mg, Matreya) was dissolved in 9 ml of ice-cold aqueous 50 mM sodium phosphate, 150 mM NaCl, pH 7.4, and chilled on ice. Ice-cold aqueous sodium periodate (20 mM, 1 ml) was added to the mixture and the reaction incubated on ice for 90 min. The selectively oxidized product was purified by reverse phase chromatography as described previously (23). Briefly, methanol (7.82 ml) and chloroform (0.36 ml) were added, and the resulting single-phase solution loaded onto pre-washed Sep-Pak C18 cartridges (Waters, 4 in series) which were then washed with 15 ml of chloroform/methanol/water (2:43:55), 7.5 ml of methanol/water (1:1), and 7.5 ml of methanol/water (4:1) prior to elution of the product with 15 ml of methanol. Elution was monitored by TLC (24) developed in isopropyl alcohol/0.25% aqueous KCl (3:1), and stained for sialic acids using an acid/resorcinol reagent. Nearly all of the product eluted in the methanol fraction, and migrated slower than GD1b.

Reductive Amination

The methanol fractions were pooled and evaporated under nitrogen. Aqueous 1 M ammonium acetate, pH 6.5 (5 ml), was added, the residue dissolved, and 140 mM aqueous recrystallized sodium cyanoborohydride (0.5 ml) added. The reaction tube was flushed with nitrogen, sealed, and stirred at 42 °C for 24 h. After the incubation, methanol (4.3 ml) and chloroform (0.2 ml) were added and the product was purified by reverse phase chromatography as described above. TLC analysis, using isopropyl alcohol/aqueous M ammonium acetate (3:1) as developing solvent, revealed a less mobile product which stained positively for the presence of both sialic acid (resorcinol reagent) and primary amine (fluorescamine reagent).

Azido-GD1b

Aryl azide reactions were performed in foil-wrapped tubes and/or away from direct sunlight to minimize photolysis. A portion (83%) of the amine product was evaporated under nitrogen in a 1.5-ml microcentrifuge tube, and 1 ml of 10 mM sulfosuccinimidyl 2-(p-azidosalicylamido)ethyl-1,3'-dithiopropionate (Pierce), 10 mM triethylamine in dimethyl sulfoxide/ethanol (1:1) was added. After 36 h with end-over-end mixing at ambient temperature in the dark, methanol (3.8 ml), chloroform (0.2 ml), and water (5.5 ml) were added and the product purified by reverse phase chromatography as above. TLC analysis, using isopropyl alcohol/aqueous 1 M ammonium acetate (3:1) or chloroform/methanol/aqueous 1 M ammonium acetate (60:35:8) as developing solvents, revealed a more mobile product which adsorbed UV light (on fluorescence-impregnated TLC plates) and stained for the presence of sialic acid (resorcinol reagent).

Fractions from the reverse phase column containing the desired product were evaporated under nitrogen, then under vacuum. The residue was dissolved in 600 µl of running solvent (isopropyl alcohol/ aqueous 1 M ammonium acetate (9:2)), loaded onto a silicic acid column (Iatrobeads, 100-µm bead size, 0.7 × 15 cm), and eluted in the same solvent. Fractions containing product (as monitored by TLC) were combined, evaporated to dryness, and re-chromatographed on the same column. Fractions containing product were combined, evaporated, and subjected to reverse phase chromatography as described above. Product was stored in methanol at -20 °C.

The final product migrated as a single spot (resorcinol positive, UV absorbent) by TLC in two solvent systems (isopropyl alcohol/aqueous M ammonium acetate (3:1) and chloroform/methanol/aqueous 1 M ammonium acetate (60:35:8)). For quantification, an aliquot was hydrolyzed (100 mM HCl, 250 mM NaCl, 80 °C, 2 h) and the released N-acetylneuraminic acid was analyzed using Dionex anion exchange high performance liquid chromatography with pulsed amperometric detection (25), revealing a final yield of 1.0 mg (8.8% overall). The azido-GD1b product was further characterized by fast atom bombardment mass spectrometry (Fig. 2). Two prominent molecular ions were detected, corresponding to the two sphingosine lengths (C20 and C18) on bovine brain gangliosides. Ions corresponding to fragmentation at the disulfide, a disulfide conjugate with the mass spectrometry matrix (monothioglycerol), and the loss of the derivatized sialic acid were also prominent, demonstrating selective modification of the terminal sialic acid residue.


Fig. 2. Fast atom bombardment mass spectrometry of azido-GD1b. The sample in methanol was mixed with an equal volume of monothioglycerol (MTG), applied to the probe tip of a Kratos Concept 3 mass spectrometer, and subjected to analysis in the negative mode. Areas of the spectrum corresponding to the molecular ions (representing the two sphingosine chain lengths in bovine brain gangliosides), as well as prominent fragment ion pairs (as indicated on the structural diagram) are presented.

[View Larger Version of this Image (33K GIF file)]


Radioiodination

An aliquot of azido-GD1b (10 nmol) was evaporated under nitrogen in a 1.5-ml microcentrifuge tube. The residue was dissolved in 100 µl of methanol, then 400 µl of 0.1 M sodium phosphate (pH 7.2) and two IODO-BEADS (Pierce) were added. After 5 min at ambient temperature, 1 mCi of sodium iodine (carrier free) was added. After 30 min, the reaction solution was added to a glass culture tube containing 4.2 ml of methanol, 5.1 ml of water, and 200 µl of chloroform. The resulting solution was loaded on a Sep-Pak C18 cartridge, which was then washed with 8 ml of chloroform/methanol/water (2:43:55), 4 ml of methanol/water (1:1), and 4 ml of methanol/water (4:1). The initial wash eluent contains unreacted Na125I and should be handled with appropriate caution. The radioiodinated product was then eluted with 4 ml of methanol, the solvent evaporated under nitrogen, and the product redissolved in 1 ml of chloroform/methanol/water (4:8:3) and stored at -20 °C.

Radioiodinated azido-GD1b was analyzed by TLC using chloroform/ methanol/aqueous 1 M ammonium acetate (60:35:8) as developing solvent. Autoradiography indicated that the radiolabel migrated with the same mobility as unlabeled azido-GD1b, which was added as carrier and detected by resorcinol staining (Rf 0.3). When an aliquot of the radiolabeled product was treated with dithiothreitol (5 mM in ethanol/water (1:1) adjusted to pH 10, 37 °C, 30 min) and subjected to TLC (as above), the radioactivity migrated with the solvent front, separate from the resorcinol-stained residual ganglioside moiety. The specific radioactivity of the ligand was 12.1 µCi/nmol (4.5 × 105 Bq/nmol).

Azido-GD1b Photoaffinity Labeling of Tetanus Toxin C Fragment

Lyophilized tetanus toxin C fragment (Boehringer Mannheim) was reconstituted at the desired concentrations in reaction buffer (25 mM Tris-HCl, pH 6.5, adjusted to 100 µM with phosphatidylserine to reduce ganglioside binding to the reaction tubes). As indicated, potential ganglioside inhibitors (GT1b, GM3, GM1; Matreya), were dried under nitrogen from stock solutions, dissolved in reaction buffer, added at the indicated concentrations to the tetanus toxin C fragment and allowed to incubate with gentle agitation at 4 °C for 30 min prior to addition of radioligand. An aliquot of 125I-azido-GD1b was evaporated under nitrogen and reconstituted in reaction buffer. The ligand was added to the reaction to yield a final concentration of 0.4 µM in a total reaction volume of 100 µl. Tetanus toxin C fragment concentration was 1 µg/reaction. Reactions were incubated at 4 °C for 3 h in the dark with gentle agitation. Following incubation, the reactions were individually transferred, using glass micropipettes, to a quartz vial designed to fit directly on top of a Vivitar 352 xenon flash lamp (kindly provided by Dr. Tae Ji, University of Wyoming). Each reaction was exposed to one photoflash. The reactions were then transferred back to glass tubes, lyophilized, and subjected to polyacrylamide gel electrophoresis as described below.

Proteolysis of Tetanus Toxin C Fragment

Tetanus toxin C fragment samples (unlabeled or photoaffinity labeled) were lyophilized and reconstituted in 98 µl of digestion buffer (100 mM Tris-HCl, pH 7.5, 1 mM CaCl2, 2 mM dithiothreitol, 10% (v/v) acetonitrile) and incubated at 65 °C for 45 min. The samples were then cooled to room temperature, and 0.5 µg of clostripain (sequencing grade, Promega) was added for each microgram of protein to be proteolyzed. The reactions were incubated at 37 °C for 16 h with gentle agitation, then lyophilized and reconstituted for gel electrophoresis (prelabeled material) or subsequent labeling with 125I-azido-GD1b.

For experiments in which peptides were labeled following proteolytic cleavage, proteolyzed material was reconstituted in reaction buffer, ganglioside inhibitors (10 µM) added as indicated, incubated with gentle agitation at 4 °C for 30 min, 125I-azido-GD1b then added, and reactions incubated and then photolyzed as described for intact tetanus toxin C fragment (above). For sequencing reactions, 20 µg of unlabeled tetanus toxin C fragment was proteolyzed as above and resolved by Tricine2 SDS-PAGE in lanes adjacent to 125I-azido-GD1b-labeled tetanus toxin C fragment peptides.

Tricine SDS-PAGE of Proteolytic Fragments

After tetanus toxin C fragment proteolysis, the resulting polypeptides were resolved by Tricine SDS-PAGE as described (26). Lyophilized hydrolysates (above) were reconstituted in 25 µl of solubilization buffer (4% SDS, 12% glycerol, 50 mM Tris-HCl, pH 6.8, 2% beta -mercaptoethanol, 0.01% bromphenol blue) and incubated at 37 °C for 60 min prior to loading onto gels. Polyacrylamide gels (0.75-mm thick) were prepared as described (26), with a resolving, spacer, and stacker gels consisting of 16.5, 10, and 6% total monomer concentration, respectively (all at 3% cross-linker). Running buffers were 0.1 M Tris base, 0.1 M Tricine, 0.1% SDS, pH 8.25, for the cathode, and 0.2 M Tris base, pH 8.9, for the anode. The gel was run at 30 mA for 1 h (or until the samples entered the stacker) then at 90 V for approx 16 h. After electrophoresis, the gel was fixed for 30 min (40% methanol, 10% acetic acid), stained (10% acetic acid, 0.025% Coomassie Blue), destained (10% acetic acid), and dried. Radiolabel distribution in the gels was analyzed by PhosphorImager analysis (Fuji BAS 1000) or x-ray film autoradiography.

Peptide Sequencing

Transfer of peptides from Tricine SDS-PAGE to polyvinylidene difluoride membranes (Bio-Rad) was performed using a Bio-Rad transblot apparatus. Gels were treated for 30 min in transfer buffer (25 mM Tris, 192 mM glycine), apposed to methanol-treated polyvinylidene difluoride membranes, and polypeptides transferred at 60 V for 4 h at 4 °C. Following transfer, membranes were stained (10% acetic acid, 40% methanol, 0.5% Coomassie Blue), bands of interest excised, and automated microsequencing performed (Biosynthesis and Sequencing Facility, The Johns Hopkins School of Medicine).

MALDI-MS

The 34-amino acid carboxyl-terminal domain of tetanus toxin was synthesized and purified by the Biosynthesis and Sequencing Facility of the Johns Hopkins School of Medicine. Purified peptide (2 µg, 0.5 nmol) and azido-GD1b (0, 0.5, or 1 nmol, not radioiodinated) in a total volume of 100 µl of 25 mM Tris-HCl, pH 6.5, were incubated for 3 h at 4 °C in the dark, then photolyzed as described above. Dithiothreitol (10 µl, 50 mM) was added and reactions incubated in the dark for 60 min at ambient temperature. Each reaction was diluted to 1 ml with acetonitrile/water/trifluoracetic acid (15:85:0.1) and loaded onto prewashed reverse phase cartridges (tC18 Sep-Pak, Waters). The cartridges were washed with 2 ml each of the loading solvent and acetonitrile/water/trifluoracetic acid (30:70:0.1), then peptide eluted with acetonitrile/water/trifluoracetic acid (70:30:0.1). The eluate was evaporated under vacuum, redissolved in 10 µl of acetonitrile/water (7:3) and subjected to matrix-assisted laser desorption/ionization mass spectrometry (MALDI-MS (27)). Spectra were acquired by drying 0.3 µl of the sample, 0.3 µl of saturated ammonium sulfate, and 0.3 µl of matrix (saturated alpha -cyano-4-hydroxycinnamic acid, Aldrich Chemical Co.) on the probe. Samples were analyzed in linear positive mode on a Kratos Kompact MALDI 4 (Kratos Analytical, Manchester, UK) equipped with a 337-nm nitrogen laser and 20 kV extraction voltage. Spectra were the result of averaging 50-100 laser shots. Partial proteolysis of the peptides was performed on the mass spectrometry probe (28). Sample (0.3 µl), 25 mM ammonium bicarbonate, pH 7.8 (0.9 µl), and enzyme (0.3 µl of trypsin (1 mg/ml), chymotrypsin (2 mg/ml), or endoproteinase GluC (2 mg/ml)) were placed on the probe, incubated 5 min at ambient temperature, then 0.3 µl of matrix was added, the sample dried, and spectra acquired. In one experiment, the sample was incubated with trypsin on the probe as above, then 0.3 µl of carboxypeptidase P (0.7 mg/ml) was added, the reaction allowed to proceed 1.5 min, prior to addition of matrix (0.3 µl). All enzymes were sequencing grade and were obtained from Boehringer Mannheim (Indianapolis, IN).


RESULTS

Incubation of tetanus toxin C fragment with 125I-azido-GD1b, followed by photoflash activation, produced radiolabeling of a polypeptide band which co-migrated with the tetanus toxin C fragment (Fig. 3A). When tetanus toxin C fragment was preincubated with ganglioside GT1b prior to reaction with 125I-azido-GD1b, radiolabeling was inhibited (Fig. 3B). Half-maximal inhibition of 125I-azido-GD1b labeling of tetanus toxin C fragment occurred at approx 1 µM GT1b. Preincubation of tetanus toxin C fragment with ganglioside GM3 to a concentration of 50 µM was without significant effect on subsequent radiolabeling (Fig. 3B), whereas preincubation with ganglioside GM1 resulted in half-maximal inhibition at approximately 10 µM (data not shown), consistent with previously published inhibition studies (5).


Fig. 3. 125I-Azido-GD1b labeling of tetanus toxin C fragment. A, tetanus toxin C fragment (1 µg/reaction) was photoaffinity labeled with 125I-azido-GD1b in the presence or absence of ganglioside inhibitors. The reactions were resolved by Tricine SDS-PAGE, tetanus toxin C fragment (approx 50 kDa) was stained with Coomassie Blue (lower panel), and co-migrating radiolabel incorporation was visualized by autoradiography (upper panel). Reactions contained the following ganglioside inhibitors: lane 1, 50 nM GT1b; lane 2, 100 nM GT1b; lane 3, 1 µM GT1b; lane 4, 10 µM GT1b; lane 5, 50 µM GT1b; lane 6, no inhibitor; lane 7, 50 µM GM3; lane 8, 10 µM GM3; lane 9, 1 µM GM3; lane 10, 100 nM GM3; and lane 11, 50 nM GM3. B, PhosphorImager quantification of radiolabeled tetanus toxin C fragment in the above reactions.

[View Larger Version of this Image (35K GIF file)]


Tetanus toxin C fragment (1 µg/reaction) was preincubated (without inhibitor or with 10 µM of either GT1b or GM3), reacted with 125I-azido-GD1b, and proteolyzed with clostripain, and the polypeptides subjected to Tricine SDS-PAGE (Fig. 4A). Alternately, tetanus toxin C fragment was first proteolyzed with clostripain, then the mixture of fragments preincubated with inhibitors (as indicated) and photoaffinity labeled with 125I-azido-GD1b (Fig. 4B). Autoradiographic analysis of these reactions after Tricine SDS-PAGE demonstrated only one band for which radiolabeling was selectively inhibited by GT1b, regardless of whether the tetanus toxin C fragment was proteolyzed before or after reaction with 125I-azido-GD1b. This band co-migrated with a polypeptide fragment detected by Coomassie Blue staining of unlabeled proteolyzed tetanus toxin C fragment electrophoresed in an adjacent lane (not shown). In the sample which was first photoaffinity labeled, then proteolyzed, this appeared to be the only radiolabeled polypeptide fragment, in that other radiolabeled bands were lipid-related (they appeared in control reactions in which tetanus toxin C fragment was excluded, data not shown). These results suggest that a peptide fragment of tetanus toxin binds to 125I-azido-GD1b in a manner that is selectively inhibitable by 1b series gangliosides (GT1b). The observation that a comparable pattern of labeling was observed whether the 125I-azido-GD1b reaction was performed before or after proteolysis indicates that the labeled peptide is sufficient to mediate ganglioside binding (see below). Furthermore, the observation that quantitatively greater labeling of comparable amounts of tetanus toxin C fragment occurred if the 125I-azido-GD1b reaction followed proteolysis (Table I) suggests that other domains of the polypeptide may attenuate ganglioside binding.


Fig. 4. Proteolysis of tetanus toxin C fragment before or after 125I-azido-GD1b labeling. Intact (A) or clostripain-proteolyzed (B) tetanus toxin C fragment (1 µg/reaction) was photoaffinity labeled with 125I-azido-GD1b in the absence of ganglioside inhibitors (lanes 1), or in the presence of 10 µM GT1b (lanes 2) or GM3 (lanes 3). Radiolabeled intact tetanus toxin C fragment was subsequently digested with clostripain. The reactions were resolved by Tricine SDS-PAGE and subjected to PhosphorImager analysis. The migration position of a unique clostripain proteolytic product of tetanus toxin C fragment (resolved in adjacent lanes, not shown) is indicated with arrows. The adjacent proteolytic fragment was subsequently isolated and sequenced (see text). In the reactions containing GT1b (lanes 2), the radiolabeled band which migrates just slower than the proteolytic fragment is an artifact of 125I-azido-GD1b reaction with GT1b, since it appeared in all reactions containing GT1b, including those in which the toxin fragment was omitted (data not shown).

[View Larger Version of this Image (23K GIF file)]


Table I. 125I-Azido-GD1b photoaffinity labeling of tetanus toxin C fragment before and after proteolysis

Intact or clostripain-proteolyzed tetanus toxin C fragment (1 µg/reaction) was photoaffinity labeled with 125I-azido-GD1b in the presence or absence of the indicated ganglioside inhibitors (10 µM). Radiolabeled intact tetanus toxin C fragment was subsequently digested with clostripain. All reactions were resolved on the same Tricine SDS-PAGE gel and subjected to PhosphorImager analysis. Radiolabel co-migrating with the carboxyl-terminal clostripain cleavage product (see text) was quantified.

Inhibitor Radiolabel co-migrating with tetanus toxin carboxyl-terminal polypeptide
Labeled then proteolyzed Proteolyzed then labeled

relative units (of control)
None 28.4 (100) 169 (100)
GT1b  0 (0) 49 (29)
GM3 54.3 (191) 197 (116)

In a separate experiment, clostripain proteolysis of unlabeled tetanus toxin C fragment was repeated using 20 µg of unlabeled tetanus toxin C fragment per reaction. 125I-azido-GD1b-labeled polypeptide and clostripain-proteolyzed unlabeled tetanus toxin C fragments were resolved in adjacent lanes on the same Tricine SDS-PAGE gel. Following electrophoresis, the gel was sliced in half. The side containing radiolabeled tetanus fragments was analyzed by autoradiography, whereas the side containing the lanes of unlabeled tetanus fragments was subjected to electrotransfer to a polyvinylidene difluoride membrane. Based upon the mobility of the GT1b-inhibitable radiolabeled band, a rectangle of polyvinylidene difluoride membrane was excised from the lane containing proteolyzed unlabeled tetanus toxin C fragment and subjected to microsequencing. The results indicated a peptide with amino-terminal sequence DILIASNXYFNHLKDKILG (where X represents no determination). This sequence corresponds to the amino acids following the clostripain cleavage site closest to the carboxyl terminus of tetanus toxin (Fig. 5). Therefore the clostripain cleavage product of tetanus toxin C fragment which is labeled with 125I-azido-GD1b in a GT1b-inhibitable manner is consistent with its identification as the carboxyl-terminal 34 amino acids of tetanus toxin: DILIASNWYFNHLKDKILGCDWYFVPTDEGWTND (Fig. 5).


Fig. 5. Sequence comparisons of the carboxyl termini of Clostridial toxins. The sequence of the clostripain proteolytic product of tetanus toxin C fragment which co-migrates with the 125I-azido-GD1b labeled fragment, representing the carboxyl-terminal 34 amino acids of tetanus toxin, is shown. Six homologous botulinum toxin sequences are included for comparison, in rank order (top to bottom) of their reported abilities to be inactivated by ganglioside GT1b (9). Sequence similarity (indicated by shading) is based on BOXSHADE (http://ulrec3.unil.ch/software/BOX_form.html). Numbers relate to the amino acid sequence of intact tetanus toxin (11).

[View Larger Version of this Image (24K GIF file)]


The 34-amino acid carboxyl-terminal domain of tetanus toxin was synthesized and purified by reverse phase chromatography. MALDI-MS revealed the appropriate calculated molecular mass of the underivatized polypeptide (Fig. 6, spectrum 1). Incubation with equimolar or 2-fold molar excess of azido-GD1b (not radiolabeled) resulted in production of a new molecular species consistent with covalent modification with a single 2-(p-aminosalicylamido)ethanethiol group (Fig. 6, spectra 2 and 3). No comparable molecular species was detected if the same incubation was performed in the absence of azido-GD1b (data not shown). Incubation of the polypeptide with higher molar ratios of azido-GD1b did not result in multiple azide derivatization, although additional masses appeared (e.g. Fig. 6, spectrum 3, and data not shown) which did not correspond to labeled polypeptide.


Fig. 6. MALDI-MS of the synthetic polypeptide corresponding to the carboxyl-terminal 34 amino acids of tetanus toxin, and its photoaffinity labeled derivative. Spectra for the underivatized 34-mer polypeptide (spectrum 1) and products resulting from incubation of the polypeptide with equimolar (spectrum 2) and 2-fold molar excess (spectrum 3) of azido-GD1b were obtained as described under "Materials and Methods." The spectrum of the underivatized polypeptide revealed masses consistent with the molecular ion (M + H, 4091.5) and the molecular ion less a hydroxyl (4074.5). A peak corresponding to the polypeptide derivatized with a single 2-(p-aminosalicylamido)ethanethiol group was detected in spectra 2 and 3. The additional mass/charge 4132.0 peak in spectrum 3 is a doubly charged species apparent only in reactions having >= 2-fold molar excess of the photoaffinity ligand (data not shown), and is considered an artifact.

[View Larger Version of this Image (15K GIF file)]


Proteolysis of the azide-derivatized polypeptide on the spectrometry probe revealed masses consistent with proteolytic fragments derivatized with a single 2-(p-aminosalicylamido) ethanethiol group (Fig. 7, Table II). Appearance of labeled fragments corresponding to amino acids 2-14 (GluC, Fig. 7, spectrum 1), 1-16 (trypsin, Fig. 7, spectrum 2), and 11-22 (chymotrypsin, Fig. 7, spectrum 3) indicated derivatization of one of the amino acids between 11 and 14. Carboxypeptidase P treatment of the trypsin fragment confirmed this observation (Fig. 8, Table II), in that sequentially cleaved derivatized fragments from 1-16 to 1-12 were detected, whereas only the underivatized fragment corresponding to amino acids 1-11 was found. This indicated that the major site of azido derivatization was at amino acid 12, corresponding to His1293 of the tetanus toxin sequence.


Fig. 7. MALDI-MS of proteolyzed photoaffinity labeled polypeptide. The synthetic 34-amino acid carboxyl-terminal polypeptide of tetanus toxin derivatized with azido-GD1b (see Fig. 6) was treated on the probe with endoproteinase GluC (spectrum 1), trypsin (spectrum 2), or chymotrypsin (spectrum 3). Masses corresponding to expected polypeptides derivatized with a single 2-(p-aminosalicylamido)ethanethiol group were detected in each case (see Table II for interpretation).

[View Larger Version of this Image (23K GIF file)]


Table II. Peptides and photoaffinity labeled peptides detected by MALDI mass spectrometry

The indicated synthetic peptides or photoaffinity labeled peptide masses were detected by MALDI mass spectrometry (see Figs. 6, 7, 8). Enzymatic cleavage was performed on the spectrometer probe as detailed under "Materials and Methods." Enzymes used were: Tryp, trypsin; GluC, endoproteinase GluC; Chym, chymotrypsin; and CP, carboxypeptidase P. Peptide residues 1-34 correspond to tetanus toxin amino acids 1282-1315.

Peptide Residues Enzyme Azido Calculated mass Observed mass

Da
DILIASNWYFNHLKDKILGCDWYFVPTDEGWTND (+H) 1-34  -  - 4091.5 4091.6
DILIASNWYFNHLKDKILGCDWYFVPTDEGWTND (+Na) 1-34  - + 4323.8 4329.2
DILIASNWYFNHLKDK (+H) 1-16 Tryp + 2188.5 2189.2
 ILIASNWYFNHLKD (+H) 2-14 GluC + 1945.2 1943.8
          NHLKDKILGCDWY (+H) 11-23 Chym + 1816.1 1815.5
          NHLKDKILGCDW (+H) 11-22 Chym + 1652.9 1652.3
DILIASNWYFNHLKD (+H) 1-15 Tryp/CP + 2060.3 2059.3
DILIASNWYFNHLK (+H) 1-14 Tryp/CP + 1945.2 1944.0
DILIASNWYFNHL (+H) 1-13 Tryp/CP + 1817.1 1812.7
DILIASNWYFNH (+H) 1-12 Tryp/CP + 1703.9 1702.7
DILIASNWYFN (+H) 1-11 Tryp/CP + 1566.8 Not found
DILIASNWYFN (+Na) 1-11 Tryp/CP  - 1378.5 1377.5


Fig. 8. MALDI-MS of trypsin and carboxypeptidase P proteolyzed photoaffinity labeled polypeptide. The synthetic 34-amino acid carboxyl-terminal polypeptide of tetanus toxin derivatized with azido-GD1b (see Fig. 6) was treated on the probe first with trypsin (5 min) then with carboxypeptidase P (90 s). Masses corresponding to peptides resulting from sequential carboxyl-terminal cleavage (1-16 to 1-11) were detected, indicating photoaffinity labeling of the His residue at position 12 (see Table II for interpretation). Areas of the spectrum surrounding peaks at 1377.5, 1702.7, and 1812.7 are expanded 5-fold, as indicated, to reveal key fragments.

[View Larger Version of this Image (24K GIF file)]



DISCUSSION

Our findings indicate that the carboxyl-terminal 34 amino acids of tetanus toxin C fragment (tetanus toxin amino acid residues 1282-1315, see Fig. 5) are sufficient to support binding of 1b series gangliosides. Moreover, this peptide is superior to the intact tetanus C fragment in supporting ganglioside binding, since there was greater 125I-azido-GD1b labeling if proteolysis was performed prior to photoaffinity labeling. A synthetic polypeptide corresponding to these 34 amino acids was specifically photolabeled by azido-GD1b.

These results agree with the findings of Halpern and Loftus (22) who reported structure-activity relationships for the binding of recombinant tetanus toxin fragments to neurons or to gangliosides at physiological pH and ionic strength. They found markedly enhanced binding of peptide 1120-1315 relative to peptide 858-1315, indicating not only that peptide 1120-1315 is sufficient to support both neuron and ganglioside binding, but that the presence of amino acids 858-1119 inhibits such binding. Whereas peptide 858-1310 supported binding to gangliosides and neurons, peptide 858-1305 did not. Although these studies indicate that amino acids 1306-1310 are required for binding, they may not bind directly to gangliosides, since peptide 1296-1315 neither bound to gangliosides nor blocked other peptides from binding, and a monoclonal antibody against peptide 1296-1315 bound to toxin-ganglioside complexes without inhibiting their interaction. In contrast, a monoclonal antibody recognizing an epitope in peptide 1236-1315 inhibited toxin-ganglioside binding and tetanus toxin-mediated toxicity (29), suggesting that amino acids within 1236-1295 may be particularly critical for direct ganglioside binding. Our results indicate that the critical residues for ganglioside binding are included in the carboxyl-terminal peptide 1282-1315, and photoaffinity labeling occurred predominantly at residue 1293. The structurally unrelated enterotoxin from another Clostridial species (Clostridium perfringens) also encodes its cell binding function in its carboxyl-terminal 30 amino acids (30).

The presence of a 34-amino acid peptide of tetanus toxin capable of independently supporting specific ganglioside binding suggests that there may be an oligosaccharide recognition domain shared among the 7 homologous Clostridial neurotoxins, all of which are known to possess some ganglioside binding activity. Alignment of the carboxyl-terminal sequences of the 6 botulinum toxins which are homologous to tetanus toxin (11-17), in rank order of their reported relative abilities to be inactivated by GT1b (9), indicates the conservation of particular residues which may mediate carbohydrate recognition (Fig. 5). Those toxins which functionally interact the least with GT1b (e.g. botulinum Types C and D) are more divergent from tetanus toxin in their carboxyl-terminal sequence compared with those which are most inhibited by GT1b. The site of photoaffinity labeling (His1293) is near two lysine residues (Lys1295 and Lys1297) which may bind the sialic acid carboxylate(s). Furthermore, tetanus toxin binding to neural membranes exhibits a pH maximum near the pK of histidine (pH 6, Ref. 6). Enhanced binding at low pH may reflect protonation of His1293 near the sialic acid binding pocket. Botulinum toxins B, F, A, and E have one or more cationic amino acids at comparable positions on their carboxyl-terminal structures (Fig. 5).

All of the above toxins are encoded episomally within Clostridial species (i.e. in phage or plasmid) (1). This fact raises the possibility that toxin sequences may have originally been found in vertebrate host genes, and then adopted by these bacteria. Consequently, definition of the amino acid sequences necessary for ganglioside recognition in Clostridial toxins may aid in identification of vertebrate proteins with similar carbohydrate binding functions.

Tetanus toxin C fragment, while itself nontoxic, retains not only the ganglioside binding activity of native tetanus toxin, but also its selective cytologic mobility (e.g. motorneuronal retrograde axonal transport and subsequent retrograde transynaptic transfer), albeit with some loss of transport efficiency (18, 31-34). It remains to be determined whether the tetanus toxin peptide comprising amino acids 1282-1315, which our data indicate contains the ganglioside-binding domain of the toxin, also retains this cytologic mobility. If true, this would suggest a role for gangliosides in intracellular targeting of endocytosed ligands.


FOOTNOTES

*   This work was supported in part by a grant from The Paralyzed Veterans of America Spinal Cord Research Foundation and by National Institutes of Health Grants K08 NS01518 (to R. E. S.), R01 NS37096 (to R. L. S.), and R01 GM54882 (to R. J. C).The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
§   To whom correspondence should be addressed: Dept. of Neurology, College of Medicine, Given Building B202, University of Vermont, Burlington, VT 05405. Tel.: 802-656-1480; Fax: 802-656-5844; E-mail: robert.shapiro{at}vtmednet.org.
par    Supported in part by National Institutes of Health Training Grant GM07626.
1   Ganglioside nomenclature is according to Svennerholm (35).
2   The abbreviations used are: Tricine, N-tris(hydroxymethyl)methylglycine; MALDI-MS, matrix-assisted laser desorption/ionization mass spectrometry; PAGE, polyacrylamide gel electrophoresis.

ACKNOWLEDGEMENTS

We thank Jodie Franklin, Biosynthesis and Sequencing Facility, The Johns Hopkins School of Medicine, for excellent polypeptide sequencing, synthesis, and purification, and Dr. Tae Ji, University of Wyoming, for providing advice and equipment for photoaffinity labeling.


REFERENCES

  1. Niemann, H. (1991) in Sourcebook of Bacterial Protein Toxins (Alouf, J. E., and Freer, J., eds), pp. 303-348, Academic Press, London
  2. Habermann, E., and Dreyer, F. (1986) Curr. Top. Microbiol. Immunol. 129, 93-179 [Medline] [Order article via Infotrieve]
  3. van Heyningen, S. (1980) Pharmacol. Ther. 11, 141-157 [CrossRef][Medline] [Order article via Infotrieve]
  4. Wellhoner, H. H. (1982) Rev. Physiol. Biochem. Exp. Pharmacol. 93, 1-68
  5. Rogers, T. B., and Snyder, S. H. (1981) J. Biol. Chem. 256, 2402-2407 [Free Full Text]
  6. Morris, N. P., Consiglio, E., Kohn, L. D., Habig, W. H., Hardegree, M. C., and Helting, T. B. (1980) J. Biol. Chem. 255, 6071-6076 [Free Full Text]
  7. Holmgren, J., Elwing, P., Fredman, P., and Svennerholm, L. (1980) Eur. J. Biochem. 106, 371-379 [Medline] [Order article via Infotrieve]
  8. Kitamura, M., Iwamori, M., and Nagai, Y. (1980) Biochim. Biophys. Acta 628, 328-335 [Medline] [Order article via Infotrieve]
  9. Kozaki, S., Sakaguchi, G., Nishimura, M., Iwamori, M., and Nagai, Y. (1984) FEMS Microbiol. Lett. 211, 219-223 [CrossRef]
  10. Kozaki, S., Ogasawara, J., Shimote, Y., Kamata, Y., and Sakaguchi, G. (1987) Infect. Immun. 55, 3051-3056 [Abstract/Free Full Text]
  11. Eisel, U., Jarausch, W., Goretzki, K., Henschen, A., Engels, J., Weller, U., Hudel, M., Habermann, E., and Niemann, H. (1986) EMBO J. 5, 2495-2502 [Medline] [Order article via Infotrieve]
  12. Binz, T., Kurazono, H., Wille, M., Frevert, J., Wernars, K., and Niemann, H. (1990) J. Biol. Chem. 265, 9153-9158 [Abstract/Free Full Text]
  13. Whelan, S. M., Elmore, M. J., Bodsworth, N. J., Brehm, J. K., Atkinson, T., and Minton, N. P. (1992) Appl. Envir. Microbiol. 58, 2345-2354 [Abstract/Free Full Text]
  14. Kimura, K., Fujii, N., Tsuzuki, K., Murakami, T., Indoh, T., Yokosawa, N., Takeshi, K., Syuto, B., and Oguma, K. (1990) Biochem. Biophys. Res. Commun. 171, 1304-1311 [CrossRef][Medline] [Order article via Infotrieve]
  15. Binz, T., Kurazono, H., Popoff, M. R., Eklund, M. W., Sakaguchi, G., Kozaki, S., Krieglstein, K., Henschen, A., Gill, D. M., and Niemann, H. (1990) Nucleic Acids Res. 18, 5556 [Free Full Text]
  16. Whelan, S. M., Elmore, M. J., Bodsworth, N. J., Atkinson, T., and Minton, N. P. (1992) Eur. J. Biochem. 191, 657-667
  17. East, A. K., Richardson, P. T., Allaway, D., Collins, M. D., Roberts, T. A., and Thompson, D. E. (1992) FEMS Microbiol. Lett. 96, 225-230 [CrossRef]
  18. Bizzini, B., Stoeckel, K., and Schwab, M. (1977) J. Neurochem. 28, 529-542 [CrossRef][Medline] [Order article via Infotrieve]
  19. Schengrund, C.-L., DasGupta, B. R., and Ringler, N. J. (1991) J. Neurochem. 57, 1024-1032 [CrossRef][Medline] [Order article via Infotrieve]
  20. Kozaki, S., Miki, A., Kamata, Y., Ogasawara, J., and Sakaguchi, G. (1989) Infect. Immun. 57, 2634-2639 [Abstract/Free Full Text]
  21. Kamata, Y., Kimura, Y., Hiroi, T., Sakaguchi, G., and Kozaki, S. (1993) Biochim. Biophys. Acta 1156, 213-218 [Medline] [Order article via Infotrieve]
  22. Halpern, J. L., and Loftus, A. (1993) J. Biol. Chem. 268, 11188-11192 [Abstract/Free Full Text]
  23. Schnaar, R. L. (1994) Methods Enzymol. 230, 348-370 [Medline] [Order article via Infotrieve]
  24. Schnaar, R. L., and Needham, L. K. (1994) Methods Enzymol. 230, 371-389 [Medline] [Order article via Infotrieve]
  25. Manzi, A. E., Diaz, S., and Varki, A. (1990) Anal. Biochem. 188, 20-32 [CrossRef][Medline] [Order article via Infotrieve]
  26. Schagger, H., and von Jagow, G. (1987) Anal. Biochem. 166, 368-379 [CrossRef][Medline] [Order article via Infotrieve]
  27. Chevrier, M. R., and Cotter, R. J. (1991) Rapid Commun. Mass Spectrom. 5, 611-617 [CrossRef][Medline] [Order article via Infotrieve]
  28. Woods, A. S., Huang, A. Y. C., Cotter, R. J., Pasternack, G. R., Pardoll, D. M., and Jaffee, E. M. (1995) Anal. Biochem. 226, 15-25 [CrossRef][Medline] [Order article via Infotrieve]
  29. Andersen-Beckh, B., Binz, T., Kurazono, H., Mayer, T., Eisel, U., and Niemann, H. (1989) Infect. Immun. 57, 3498-3505 [Abstract/Free Full Text]
  30. Hanna, P. C., Mietzner, T. A., Schoolnik, G. K., and McClane, B. A. (1991) J. Biol. Chem. 266, 11037-11043 [Abstract/Free Full Text]
  31. Schwab, M. E., and Thoenen, H. (1976) Brain Res. 105, 213-227 [CrossRef][Medline] [Order article via Infotrieve]
  32. Weller, U., Taylor, C. F., and Habermann, E. (1986) Toxicon 24, 1055-1063 [Medline] [Order article via Infotrieve]
  33. Evinger, C., and Erichsen, J. (1986) Brain Res. 380, 383-388 [CrossRef][Medline] [Order article via Infotrieve]
  34. Buttner-Ennever, J. A., Grob, P., Akert, K., and Bizzini, B. (1981) Neurosci. Lett. 26, 233-238 [CrossRef][Medline] [Order article via Infotrieve]
  35. Svennerholm, L. (1994) Prog. Brain Res. 101, xi-xiv

Volume 272, Number 48, Issue of November 28, 1997 pp. 30380-30386
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Infect. Immun.Home page
B. P. Mullaney, M. G. Pallavicini, and J. D. Marks
Epitope Mapping of Neutralizing Botulinum Neurotoxin A Antibodies by Phage Display
Infect. Immun., October 1, 2001; 69(10): 6511 - 6514.
[Abstract] [Full Text] [PDF]


Home page
Cereb CortexHome page
D. Maric, I. Maric, Y. H. Chang, and J. L. Barker
Stereotypical Physiological Properties Emerge During Early Neuronal and Glial Lineage Development in the Embryonic Rat Neocortex
Cereb Cortex, August 1, 2000; 10(8): 729 - 747.
[Abstract] [Full Text] [PDF]


Home page
Physiol. Rev.Home page
G. Schiavo, M. Matteoli, and C. Montecucco
Neurotoxins Affecting Neuroexocytosis
Physiol Rev, April 1, 2000; 80(2): 717 - 766.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Palestini, M. Pitto, G. Tedeschi, A. Ferraretto, M. Parenti, J. Brunner, and M. Masserini
Tubulin Anchoring to Glycolipid-enriched, Detergent-resistant Domains of the Neuronal Plasma Membrane
J. Biol. Chem., March 31, 2000; 275(14): 9978 - 9985.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Emsley, C. Fotinou, I. Black, N. F. Fairweather, I. G. Charles, C. Watts, E. Hewitt, and N. W. Isaacs
The Structures of the HC Fragment of Tetanus Toxin with Carbohydrate Subunit Complexes Provide Insight into Ganglioside Binding
J. Biol. Chem., March 17, 2000; 275(12): 8889 - 8894.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. C. Williamson, K. E. Bateman, J. C. M. Clifford, and E. A. Neale
Neuronal Sensitivity to Tetanus Toxin Requires Gangliosides
J. Biol. Chem., August 27, 1999; 274(35): 25173 - 25180.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Fotinou, P. Emsley, I. Black, H. Ando, H. Ishida, M. Kiso, K. A. Sinha, N. F. Fairweather, and N. W. Isaacs
The Crystal Structure of Tetanus Toxin Hc Fragment Complexed with a Synthetic GT1b Analogue Suggests Cross-linking between Ganglioside Receptors and the Toxin
J. Biol. Chem., August 17, 2001; 276(34): 32274 - 32281.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Shapiro, R. E.