Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Stigson, M.
Right arrow Articles by Kjellén, L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Stigson, M.
Right arrow Articles by Kjellén, L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Volume 272, Number 6, Issue of February 7, 1997 pp. 3246-3253
©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

PG-M/Versican-like Proteoglycans Are Components of Large Disulfide-stabilized Complexes in the Axolotl Embryo*

(Received for publication, June 5, 1996, and in revised form, October 11, 1996)

Michael Stigson Dagger , Jan Löfberg § and Lena Kjellén

From the Department of Veterinary Medical Chemistry, Swedish University of Agricultural Sciences, The Biomedical Center, S-751 23 Uppsala and the § Department of Environmental and Developmental Biology, Uppsala University, Norbyvägen 18 A, S-752 36 Uppsala, Sweden

ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
FOOTNOTES
Acknowledgments
REFERENCES


ABSTRACT

Large disulfide-stabilized proteoglycan complexes were previously shown to be synthesized by the epidermis of axolotl embryos during stages crucial to subepidermal migration of neural crest cells. We now show that the complexes contain PG-M/versican-like monomers in addition to some other component with low buoyant density. Metabolically 35S-labeled proteoglycans were extracted from epidermal explants and separated by size exclusion chromatography and density equilibrium gradient centrifugation. The complexes, which elute in the void volume on Sepharose CL-2B, were recovered at buoyant density 1.42 g/ml in CsCl gradients, whereas the monomer proteoglycans, which could only be liberated from the complexes by reduction, had a higher buoyant density (1.48 g/ml). The native complexes did not aggregate with hyaluronan. The purified complexes reacted with antibodies against a portion of a cloned PG-M/versican-like axolotl proteoglycan. These antibodies were found to stain the subepidermal matrix of axolotl embryos, suggesting that the proteoglycan complexes are encountered by neural crest cells during subepidermal migration. From Western blot analysis, the core protein of the PG-M/versican-like monomers was found to be of similar size (approx 500 kDa) as those of PG-M/versican variants of other species. Another chondroitin sulfate proteoglycan that was present in small amounts in the epidermal extracts was found to be distinctly different from the similarly sized PG-M/versican-like monomers.


INTRODUCTION

The role of proteoglycans (PGs)1 in the modulation of cell-matrix interaction and cell migration depends on their structure and localization (1-3). Interstitial PGs that carry chondroitin/dermatan sulfate (CS/DS) chains have been implicated to have such modulatory roles by several studies (4-18). In this regard, since both the core protein (7, 18-19) and the glycosaminoglycan moiety (15, 18, 20) appear to be of functional importance, the structure of the intact PG may be crucial (9, 18). In addition to the inherent potential for heterogeneity in the carbohydrate component (21), the core proteins of PGs in the PG-M/versican family, for instance, may exist as several splice variants (22-25) with potentially diverse expression patterns and functions during various stages of the life cycle of an animal.

The importance of the extracellular matrix in the regulation of subepidermal neural crest cell migration in the axolotl embryo was demonstrated by transplantation experiments in which epidermal grafts or microcarriers with matrix adsorbed in situ from developmentally more advanced embryos were found to trigger the onset of premature migration (26). Ultrastructural studies of the matrix after fixation in the presence of cetylpyridinium chloride (27) or ruthenium red (28-30) revealed an abundance of granular proteoglycan precipitates along collagen fibrils. Interestingly, in embryos of the white mutant axolotl, in which subepidermal migration of the neural crest-derived pigment cells is defective (28-29, 31), the subepidermal matrix was significantly less granulated (27, 29-30) suggesting a potential role of the PGs in the matrix.

In an attempt to isolate and characterize the PGs that might be encountered by migrating neural crest cells in the axolotl embryo, a previous study (32) took advantage of the possibility to utilize epidermal explants for the metabolic radiolabeling of PGs with [35S]sulfate. Dorsal trunk epidermis was explanted at a premigratory stage and was maintained in tissue culture together with radiolabel for a time period corresponding to the transition from a nonpermissive matrix to one that permits subepidermal migration of neural crest cells. It was found that the major PGs synthesized were large disulfide-stabilized PG complexes with monomer PGs in the size range of aggrecan or PG-M/versican but with unusually large (Mr approx 150,000) chondroitin/dermatan sulfate (CS/DS) side chains. In the present work these complexes are further studied, and their PG component is purified, characterized, and identified. We report that the complexes contain PG-M/versican-like PG monomers in addition to some other component of low buoyant density. Furthermore, the PG-M/versican-like monomers of the complex are shown to be distinctly different from another CSPG that is present in small amounts in the epidermal extracts.


EXPERIMENTAL PROCEDURES

Embryos

Embryos of the Mexican axolotl (Ambystoma mexicanum, Urodela, Amphibia) were obtained from the Indiana University Axolotl Colony, Bloomington, IN, and from the Department of Zoology, Uppsala University. Before manual decapsulation, eggs were sterilized in 70% ethanol and rinsed in modified Steinberg's solution (MS), composed of 58 mM NaCl, 0.67 mM KCl, 0.34 mM CaCl2, 0.83 mM MgSO4, 4.6 mM HEPES, pH 7.4 (33), supplemented with 0.05% penicillin/streptomycin. All storage, handling, and manipulations of embryos were done in sterile MS. Embryos were staged according to Bordzilovskaya et al. (34).

Metabolic Radiolabeling with [35S]Sulfate and Extraction of PGs

Using sharp tungsten needles, the epidermis was carefully removed from the dorsal trunk (the area between the levels of the gills and anus overlying the somites and neural tube/crest) of stage 30 embryos (around the onset of neural crest cell migration). The epidermal explants were incubated in MS containing 2.5 mCi/ml Na[35S]SO4 (carrier-free; DuPont NEN). After incubation for 20 h at 20 °C, corresponding to the time between stages 30 to 35 (as determined by the parallel incubation of control embryos), the labeling medium was removed and the tissue was dissolved in extraction buffer (about 400 µl per 50 explants) containing 4 M guanidine HCl, 50 mM sodium acetate, pH 5.8, and 0.2% Triton X-100, together with 1 mM N-ethylmaleimide (NEM), 100 mM epsilon -aminocaproic acid, 10 mM EDTA, and 1 mM phenylmethylsulfonyl fluoride as protease inhibitors (35). After end-over-end extraction for 24 h at 4 °C, the radiolabeled macromolecules (approx 5 × 106 cpm/100 epidermal explants) were recovered by extensive dialysis against extraction buffer. For immunoblotting, 400 epidermal explants were prepared as above but without radiolabeling. An aliquot of the 35S-labeled material was added to the unlabeled material to act as tracer during the purification steps.

Purification of PGs by Size Exclusion Chromatography, Density Equilibrium Centrifugation, and Ion Exchange Chromatography

Extracted 35S-labeled PGs were separated by chromatography on 1.2 × 100-cm columns of Sepharose CL-2B (Pharmacia Biotech Inc.) eluted with extraction buffer at 4 °C. An aliquot of each fraction was subjected to liquid scintillation analysis. The recovery of 35S radioactivity was about 65%. Size-fractionated PGs were pooled as indicated in Fig. 1A, and 0.48 g/ml CsCl was added to give an initial density of 1.42 g/ml before the samples were separated according to buoyant density in self-generated CsCl gradient by ultracentrifugation at 100,000 × g for 72 h. The specific gravity (rho ) of fractions collected from the bottom was determined by weighing, and the 35S radioactivity of each fraction was determined by liquid scintillation analysis of an aliquot. Recovery of 35S radioactivity was approx 70%. IMPGs, pooled as indicated in Fig. 1C, were diluted 40 times with a buffer containing 7 M urea, 10 mM Tris, pH 8, 0.1% Triton X-100, and a mixture of protease inhibitors (1 mM phenylmethylsulfonyl fluoride, 2 mM NEM, 2 mM EDTA, and 1 µg/ml pepstatin), and applied to a DEAE-Sephacel (Pharmacia) ion exchange column, equilibrated with a buffer containing the same ingredients together with 150 mM NaCl. After washing with equilibration buffer and a buffer containing 150 mM NaCl, 50 mM Ac-, pH 4, 0.1% Triton X-100, and the mixture of protease inhibitors, the PGs were eluted with extraction buffer.


Fig. 1. Purification of large proteoglycans (PGs) by size exclusion chromatography and density equilibrium gradient centrifugation. a, extracted 35S-labeled PGs (approx 1.3 × 106 cpm) were chromatographed on Sepharose CL-2B and eluted with extraction buffer at a flow rate of 4 ml/h. Fractions of 1.3 ml were collected, and 10 µl of these were assayed for 35S radioactivity. Two size classes of large PGs, HMPGs and IMPGs, were separately pooled as indicated by the bars. The pools of 35S-labeled HMPGs (b) and IMPGs (c), respectively, were subjected to CsCl gradient centrifugation under dissociative conditions. Fractions of approx 0.5 ml were collected from the bottom of the tubes, and aliquots of 5 µl were assayed for 35S radioactivity. HMPGs with rho  approx 1.42 g/ml (b), and IMPGs with rho approx 1.55 g/ml (c), respectively, were pooled as indicated by the bars.
[View Larger Version of this Image (18K GIF file)]


Reduction and Alkylation of HMPG Complexes

For reduction of the HMPG complexes, samples were dialyzed into a buffer of 6 M guanidine HCl, 100 mM Tris, pH 8, 0.1% Triton X-100, and the mixture of protease inhibitors excluding NEM. Dithiothreitol was added to a final concentration of 50 mM, and the sample was incubated for 16 h at room temperature, after which reduced SH groups were alkylated by addition of iodoacetamide to a final concentration of 62.5 mM and incubated for another 1 h.

Analysis of Glycosaminoglycan Side Chains

Alkaline liberation of glycosaminoglycan side chains was achieved by adding 1 volume of 0.1 M NaOH, 0.6 M NaBH4 followed by incubation at room temperature for 24 h, after which the samples were acidified, neutralized, and dialyzed against water. The chain length of the glycosaminoglycans was assessed by chromatography on a calibrated Sepharose CL-4B (Pharmacia) column as described previously (32). Blue dextran (Pharmacia) and N-2,4-dinitrophenyl-beta -alanine was used as void volume and total volume markers, respectively. 3H-Labeled hyaluronan fragments of Mr = 40,000, kindly provided by Dr. Håkan Pertoft, Department of Medical Chemistry, Uppsala University, were used as an internal standard.

Aggregation of PGs with Hyaluronan

To obtain large size hyaluronan, HealonTM (Pharmacia, Sweden) was chromatographed on Sepharose CL-2B and analyzed by the carbazole method (36), after which the void volume fraction was pooled and used for the aggregation experiment. Aggrecan from bovine nasal cartilage was kindly prepared by Dr. Erik Unger and quantitated by the carbazole method (36). 35S-Labeled HMPG complexes or IMPGs were mixed with 10 µg of hyaluronan and 1 mg of aggrecan in dissociative buffer. After dialysis into an associative buffer containing 0.5 M sodium acetate, pH 5.8, 0.1% Triton X-100, and the protease inhibitor mixture, samples were analyzed by CsCl gradient centrifugation or chromatography on 0.8 × 100-cm columns of Sepharose CL-2B in associative buffer. Samples without addition of carrier aggrecan-hyaluronan complexes were used as negative controls. As a positive control, 3H-labeled hyaluronan was centrifuged in associative CsCl gradients with and without added aggrecan. The 3H radioactivity was recovered at rho  >1.65 g/ml and rho  =1.57 g/ml, respectively (data not shown).

Additional Treatments to Dissociate the HMPG Complexes

Acid treatment was done by titrating the sample with acetic acid to pH 3.8, after which the samples were incubated for 1.5 h at +4 °C. For digestion with collagenase (form III; Advanced Biofactures, Lynnbrook, NY), samples were dialyzed into a digestion buffer of 50 mM Tris-HCl, pH 7.5, 0.36 mM CaCl2, and the mixture of protease inhibitors excluding EDTA. To test the effectiveness and specificity of the collagenase treatment, collagen and fibronectin (kindly provided by Dr. Staffan Johansson, Department of Medical Chemistry, Uppsala University) were treated in parallel under identical conditions as positive and negative controls, respectively, and analyzed by SDS-PAGE. Under these conditions, collagen was completely degraded while fibronectin was left intact (result not shown). Hyaluronidase (Seikagaku Co., Japan) treatment (5 turbidity reducing units/ml) was done in a buffer with 150 mM NaCl, 20 mM sodium acetate, pH 5.8, 0.1% Triton X-100, with protease inhibitors at 37 °C for 3 h. As a positive control of enzyme activity, 3H-labeled hyaluronan was treated in parallel under identical conditions and analyzed by chromatography on a Superose 6 HPLC column.

Chondroitinase ABC Digestion

Before digestion with chondroitinase ABC (protease-free; Seikagaku Co., Japan), the purified PG samples were dialyzed into the appropriate buffer. Digestion with chondroitinase ABC (0.1 units/ml) was done at 37 °C for 3 h in 50 mM Tris, pH 8, 30 mM NaAc, 0.1% Triton X-100, with the mixture of protease inhibitors. As a positive control of enzyme activity, aggrecan was digested under identical conditions and analyzed by SDS-PAGE and immunoblotting.

Immunoblotting

For slot blotting, the chondroitinase ABC-treated samples were diluted to <0.05% Triton X-100 in 4 M guanidine-HCl/TBS (10 mM Tris, pH 8, and 150 mM NaCl), serially diluted, and immobilized on a nitrocellulose membrane (Schleicher & Schuell) using a Bio-Dot SF Microfiltration Apparatus (Bio-Rad). For Western blotting, samples were precipitated with 10% trichloroacetic acid, rinsed in ethanol:diethyl ether (1:1), briefly dried, and dissolved in sample buffer. Reduced and alkylated samples were subjected to SDS-PAGE in 7.5% homogeneous PhastGels for 130 V-h followed by semi-dry electrotransfer for 30 min onto nitrocellulose using a Pharmacia PhastSystem. Prestained SDS-PAGE Standards (high range; Bio-Rad) and laminin (detected by Coomassie staining of parallel gels) were used as molecular weight markers. Blots were blocked with 5% non-fat milk in Tris-buffered saline, 0.1% Tween (TBS-T), washed, incubated with primary antibodies (see below) in TBS-T for 1 h at room temperature or overnight at +4 °C, washed, incubated with horseradish peroxidase-linked anti-mouse Ig or anti-rabbit Ig (Amersham Corp.; secondary antibodies diluted 1:5000) for 30 min at room temperature, washed, reacted with enhanced chemiluminescence reagent (Amersham Corp.) according to the manufacturer's instructions, and detected by exposure to Fuji RX x-ray film.

Antibodies Against Glycosaminoglycan Epitopes

Mouse monoclonal antibodies 5D4 (ascites fluid; Seikagaku) against keratan sulfate were used diluted 1:200 in TBS-T. Mouse monoclonal antibodies 1B5, 2B6, and 3B3 (ascites fluid; ICN) against the unsulfated, 4-sulfated, and 6-sulfated, respectively, unsaturated "stubs" generated by chondroitinase ABC digestion of chondroitin sulfate (37) were used as a mixture at a dilution of 1:200 in TBS-T with respect to each antibody.

Expression of a Portion of a Cloned Axolotl PG-M/Versican Homologue as a Fusion Protein

A portion of the CS attachment domain of a partially cloned axolotl PG-M/versican homologue2 was selected for expression as a fusion protein with glutathione S-transferase; the stretch of 80 amino acid residues (SAAEHAEGESDVTETKSPMTPLTAVETDEERQDVSTAYAELVSHSIRQSVTEIQDISQATYIESETAAKITPEDQTQKPS) lacks any apparent consensus signal for glycanation or N- and O-linked glycosylation and shares no apparent homology with other sequences obtained from the National Center for Biotechnology Information (World Wide Web at URL http://www3.ncbi.nlm.nih.gov). The corresponding 240-base pair nucleotide sequence, to be cloned in the correct reading frame into the BamHI/EcoRI site of the pGEX-3 (Pharmacia) expression vector, was amplified from a partial cDNA clone2 of the axolotl PG (AxPG) by polymerase chain reaction. After ligation of the polymerase chain reaction product into pGEX-3 and transfection of Escherichia coli JM83, a recombinant clone with the correct insert was selected after sequencing. The recombinant plasmid was cultured in E. coli UT5600, and after induction with isopropyl beta -D-thiogalactopyranoside, the bacteria were further cultured and lysed, after which the axolotl PG-glutathione S-transferase (AxPG-GST) fusion protein was purified by affinity chromatography on a glutathione-Sepharose (Pharmacia) column.

Preparation of Antibodies Against the AxPG-GST Fusion Protein

Rabbits were immunized intramuscularly with the purified AxPG fusion protein using standard procedures, and the production of antibodies was monitored by enzyme-linked immunosorbent assay. Anti-AxPG-GST antibodies (0.3 mg/ml) were obtained by affinity chromatography on AxPG-GST-coupled Sepharose 4B. The antibodies were used in immunoblotting (30 µg/ml in TBS-T) and immunofluorescence (as described below). As a control, similarly prepared affinity-purified antibodies against GST were used under the same conditions as the anti-AxPG-GST antibodies.

Immunofluorescence

Axolotl embryos of stage 32 or epidermal explants of stage 30 embryos after 20 h incubation were fixed overnight (embryos) or 15 min (epidermal explants) in 3% paraformaldehyde, 0.1 M phosphate buffer, pH 7.4. For whole embryos, fixative penetrance was facilitated by cutting off the head and tail. The fixed embryos and epidermal explants were rinsed in phosphate-buffered saline (PBS), dehydrated, embedded in Paraplast, and sectioned transversely. Sections were dewaxed, rehydrated, washed in PBS, and subjected to chondroitinase ABC digestion (1 unit/ml) in 50 mM Tris, pH 8, 30 mM NaAc for 30 min at 37 °C. The incubation with primary antibodies (10 µg/ml in PBS containing 0.1% bovine serum albumin) was performed overnight at 4 °C. After washing in PBS, the sections were incubated with fluorescein isothiocyanate-conjugated secondary anti-rabbit IgG antibodies (diluted 1:200 in PBS, 0.1% bovine serum albumin; Sigma) for 1 h at room temperature, after which the immunofluorescence was visualized in a fluorescence microscope. As control, anti-AxPG antibody binding was competitively blocked by the addition of a 5-fold molar excess of AxPG fusion protein to the primary antibody. Anti-GST antibodies were used as negative control.


RESULTS

To further characterize the large PG complexes previously shown to be synthesized by the epidermis of the axolotl embryo (32), explants of dorsal trunk epidermis from axolotl embryos were maintained in tissue culture for a time period corresponding to stages 30 to 35 in the presence of [35S]sulfate. After dissociative extraction and dialysis to recover macromolecular radiolabel, the 35S-labeled PGs were separated by size exclusion chromatography on Sepharose CL-2B under dissociative conditions (Fig. 1A). The high molecular weight PGs (HMPGs) eluting in the void volume fractions and PGs of intermediate molecular weight (IMPGs) eluting with Kav 0.2-0.3 were separately pooled and subjected to density equilibrium centrifugation in self-forming gradients of CsCl under dissociative conditions (rho o approx 1.42 g/ml). The HMPGs were mostly found in mid-gradient fractions with rho  approx 1.42 g/ml (Fig. 1B) which were pooled as indicated in the figure and used for further characterization. In contrast, the majority of IMPGs were recovered in fractions of significantly higher density (rho  approx 1.55 g/ml; Fig. 1C). Evidently, the rather prominent second peak that appears at rho  approx 1.42 g/ml in Fig. 1C represents contaminating HMPG which by its relative abundance is present in the IMPG pool after separation by Sepharose CL-2B chromatography. The IMPGs, pooled as indicated in the figure, were further purified from contaminating HMPG by ion exchange chromatography3 before subsequent characterization.

The HMPG fraction has previously been shown to contain PG complexes stabilized by intermolecular disulfide bonds (32). After reduction, the monomers were found to elute at a Kav of 0.2 when analyzed by Sepharose CL-2B chromatography (32). To investigate if the HMPG monomers resemble the IMPGs, the HMPG fraction obtained after chromatography on Sepharose CL-2B was subjected to CsCl gradient centrifugation before and after reduction and alkylation (Fig. 2). The reduced PGs were found at a higher buoyant density (1.48 g/ml; Fig. 2B) than the unreduced HMPGs (1.42 g/ml; Fig. 2A), indicating that the complex in addition to the HMPG monomers contain other components with lower buoyant density. Since the significantly higher buoyant density of the IMPGs (1.55 g/ml; Fig. 1C) indicated that the HMPG monomers and the IMPGs are not identical, it was decided to further compare the two PG preparations.


Fig. 2. Buoyant densities of HMPG complexes and HMPG monomers. 35S-Labeled HMPGs were subjected to CsCl gradient centrifugation under dissociative conditions before (a) and after (b) reduction and alkylation. Fractions of approx 0.5 ml were collected, and aliquots of 200 µl were assayed for 35S radioactivity.
[View Larger Version of this Image (20K GIF file)]


The HMPG Monomers Are Distinctly Different from the IMPGs

Glycosaminoglycan Chain Length

After alkaline liberation from the core protein, the glycosaminoglycan side chains of HMPG eluted significantly earlier (Kav = 0.3) than those of IMPG (Kav = 0.4) when chromatographed on a Sepharose CL-4B column (Fig. 3) that had been previously calibrated with hyaluronan standards. Relating the elution position to hyaluronan fragments, the size of the glycosaminoglycan side chains of HMPG correspond to Mr approx  150,000, as previously reported (32), whereas the glycosaminoglycan side chains of IMPG are shorter (Mr approx  75,000).


Fig. 3. Glycosaminoglycan chain length of HMPGs and IMPGs. 35S-Labeled glycosaminoglycan side chains (approx 3,000 cpm), liberated by treatment with alkaline borohydride, of purified HMPG (filled squares) and IMPG (open squares) were chromatographed on a Sepharose CL-4B column previously calibrated with hyaluronan fragments (32). The arrow shows the elution position of 3H-labeled hyaluronan fragments of Mr = 40,000, which were used as internal standard.
[View Larger Version of this Image (25K GIF file)]


Aggregation With Hyaluronan

A characteristic feature of several large PGs such as aggrecan (38), PG-M/versican (39, 40), and neurocan (41) is their ability to specifically bind to hyaluronan (i.e. noncovalent protein-carbohydrate binding) to form large supramolecular complexes. To investigate whether the HMPG complexes can bind to hyaluronan, samples of 35S-labeled HMPG without (Fig. 4A) or with (Fig. 4B) the addition of unlabeled hyaluronan and unlabeled aggrecan were dialyzed into dissociative buffer and analyzed by associative CsCl gradient centrifugation. As shown in Fig. 4, the position of the 35S-labeled HMPG in the gradient was the same in the presence and absence of the aggrecan-hyaluronan complexes (see "Experimental Procedures"). In contrast, 35S-labeled IMPG, which was run on an associative Sepharose CL-2B column under the same conditions, was found to elute in the void volume after addition of aggrecan and hyaluronan (Fig. 5). Apparently, the IMPG can form aggregates with hyaluronan, whereas the HMPG complexes lack this property. Any hyaluronan binding activity of native HMPG monomers could not be tested since such activity is destroyed by reduction. Attempts to obtain native HMPG monomers by treatment with acid (pH <4), collagenase, or hyaluronidase (see "Experimental Procedures") were unsuccessful as neither of these treatments altered the size or buoyant density of the HMPG complexes (data not shown).


Fig. 4. Hyaluronan binding activity of HMPG. CsCl gradient centrifugation of 35S-labeled HMPG under associative conditions in the absence (a) and presence (b) of exogenously added unlabeled hyaluronan and aggrecan. Fractions of approx 0.5 ml were collected, and aliquots of 200 µl were weighed and assayed for 35S radioactivity. Under the same conditions, 3H-labeled hyaluronan in the presence and absence of added aggrecan (see "Experimental Procedures") was recovered at rho  >1.65 g/ml and rho  = 1.57 g/ml, respectively.
[View Larger Version of this Image (19K GIF file)]



Fig. 5. Hyaluronan binding activity of IMPG. Sepharose CL-2B chromatography of 35S-labeled IMPG under associative conditions in the absence (a) and presence (b) of exogenously added unlabeled hyaluronan and aggrecan. Flow rate was 1 ml/h, and fractions of 0.3 ml were collected. The entire fractions were assayed for 35S radioactivity.
[View Larger Version of this Image (15K GIF file)]


Keratan Sulfate Content

To investigate if the two PG preparations contained keratan sulfate, equal amounts of 35S radioactivity of purified HMPG and IMPG were digested with chondroitinase ABC and analyzed by slot blotting, using monoclonal anti-keratan sulfate antibodies 5D4 (Fig. 6A). The antibodies reacted well with IMPG, whereas no immunoreactivity was found for HMPG. To exclude that the observed difference was due to lower amounts of HMPGs analyzed, a mixture of anti-CS-stub antibodies (see below) was also used. As shown in Fig. 6B, the HMPG staining with these antibodies was more than 5-fold stronger than that of IMPG, arguing against this possibility. The IMPGs thus resembled the aggrecans in their content of keratan sulfate, whereas the HMPGs could be more related to the PG-M/versicans.


Fig. 6. Keratan sulfate content of HMPGs and IMPGs. Samples of HMPG and IMPG (equal amount of 35S-tracer; see "Experimental Procedures"), corresponding to purified PGs from about 50 epidermal explants, were digested with chondroitinase ABC, stepwise diluted 1:4, and analyzed by slot blotting using monoclonal antibody 5D4 directed against keratan sulfate (a), and a mixture of monoclonal antibodies 3B3, 2B6, and 1B5 (36) directed against the chondroitin sulfate (CS) "stubs" remaining attached to the core protein after digestion with chondroitinase ABC (b). Indicated amounts of bovine aggrecan was used for reference.
[View Larger Version of this Image (18K GIF file)]


The HMPG Monomers Are Related to PG-M/Versican

Immunoreactivity

To investigate if the monomer PGs of the HMPG complex are related to PG-M/versican, HMPG and IMPG were purified from a large number of epidermal explants and analyzed by slot blotting (Fig. 7) using affinity-purified polyclonal antibodies (anti-AxPG-GST) raised against a fusion protein (AxPG-GST) of glutathione S-transferase and an 80-amino acid segment of the CS attachment domain of a partially cloned axolotl PG (AxPG; see "Experimental Procedures") with homology to PG-M/versican.2 Chondroitinase ABC-digested HMPG was clearly immunoreactive to these antibodies, whereas IMPG as well as bovine nasal cartilage aggrecan were unreactive. The immunopositive signal of HMPG increased after the membrane was stripped in a reducing buffer and reprobed, suggesting that reduction of the complex further exposes the core protein epitopes (data not shown).


Fig. 7. Immunoreactivity of HMPG and IMPG to antibodies against axolotl-PG-glutathione S-transferase (AxPG-GST) fusion protein. Chondroitinase ABC-digested samples of HMPG and IMPG (same amount as in Fig. 6) were serially diluted 1:4 and analyzed by slot blotting using affinity-purified anti-AxPG-GST antibodies. Indicated amounts of AxPG-GST and bovine aggrecan were used for reference.
[View Larger Version of this Image (46K GIF file)]


Core Protein Size

To estimate the size of the core protein of the HMPG monomers, the PGs purified from a large number of epidermal explants were analyzed by SDS-PAGE and immunoblotting after chondroitinase ABC treatment and reduction. Detection of the core protein by using the anti-AxPG-GST antibodies resulted in a weak band with a size (approx 500 kDa) in the same range as the core proteins of PG-M/versicans (data not shown). A stronger signal was obtained when using a mixture of the monoclonal antibodies 3B3, 2B6, and 1B5 (37), directed against the unsaturated stubs generated by digestion with chondroitinase ABC, which recognized the same band (Fig. 8). Since only CS/DS is present in the HMPG preparation (32), and only one band (approx 500 kDa) was detected with anti-CS-stub antibodies, the detected core protein must be derived from the major PG in the preparation. It thus appears unlikely that any significant amount of contaminating PGs would be present in the HMPG preparation. The core protein of IMPG could not be detected by immunoblotting using these conditions.


Fig. 8. Size of the HMPG core protein. Chondroitinase ABC (CSase ABC)-digested (+)/undigested (-), reduced and alkylated HMPGs and IMPGs (equal amount of 35S-tracer; see "Experimental Procedures") were detected with the same mixture of anti-CS-stub antibodies as in Fig. 6, after electrophoresis in a homogeneous 7.5% PhastTM SDS-PAGE gel run for 130 V-h and electroblotting to nitrocellulose membrane. The molecular weight of high molecular weight standards and reduced and alkylated laminin are indicated. Similarly treated bovine aggrecan (Aggr) was run for reference.
[View Larger Version of this Image (70K GIF file)]


Localization

The affinity-purified anti-AxPG-GST fusion protein antibodies stained the subepidermal extracellular matrix of axolotl embryos (Fig. 9A), as well as the matrix inside epidermal vesicles (Fig. 10). Immunofluorescence was found along fibrils in the matrix. This staining was inhibited by the addition of fusion protein (AxPG-GST), whereas weak unspecific fluorescence of the epidermal layer remained (Fig. 9B); antibodies against GST gave no staining (data not shown). From these results, it may be inferred that the major PGs encountered by neural crest cells in the subepidermal extracellular matrix of the axolotl embryo are PG-M/versican-like PGs that are components of large disulfide-stabilized complexes.


Fig. 9. Immunofluorescence of embryonic subepidermal extracellular matrix with antibodies against axolotl-PG-glutathione S-transferase (AxPG-GST) fusion protein. Sections of the dorsal trunk of axolotl embryos at stage 32 were incubated with anti-AxPG-GST antibodies in the absence (a) and presence (b) of exogenously added AxPG-GST fusion protein. The bound primary antibodies were detected by immunofluorescence using fluorescein isothiocyanate-conjugated anti-rabbit Ig as secondary antibodies. Ep, epidermis; NC, neural crest; NT, neural tube; S, somites. Bar = 20 µm.
[View Larger Version of this Image (85K GIF file)]



Fig. 10. Immunofluorescence of extracellular matrix of epidermal explants with antibodies against axolotl-PG-glutathione S-transferase (AxPG-GST) fusion protein. Sections of epidermal vesicles were incubated with anti-AxPG-GST antibodies and detected by immunofluorescence (a) as described in the legend to Fig. 9. To assess the extracellular matrix localization of the immunoreactivity, the same section as in a was photographed with combined immunofluorescence and phase-contrast optics (b). Bar = 10 µm.
[View Larger Version of this Image (61K GIF file)]



DISCUSSION

In the present study, antibodies against a portion of a partially cloned PG-M/versican-like axolotl PG (AxPG) expressed as a fusion protein (AxPG-GST) were demonstrated to recognize the large disulfide-stabilized PG complexes (HMPG; Fig. 7), previously found to be the major PGs synthesized by the epidermis of axolotl embryos during stages crucial to the subepidermal migration of neural crest cells (32). Another chondroitin sulfate PG (IMPG), which constitutes a minor fraction of the PGs present in epidermal extracts, was not recognized by these antibodies when equal amounts of 35S radioactivity of the purified PGs were analyzed by slot blotting (Fig. 7). Since the amount of core protein molecules present in the IMPG sample may be lower than in the HMPG sample, as indicated by the lower immunoreactivity to anti-CS stub antibodies (Fig. 6), it cannot be excluded that the IMPGs may have escaped detection with the anti-AxPG-GST antibodies (Fig. 7). It appears more likely, however, that the IMPGs which in contrast to the HMPGs were shown to contain KS (Fig. 6) may be related to the aggrecans.4

Large PGs of the extracellular matrix have been suggested to interact with a rich variety of matrix components, both proteins and carbohydrates. Interactions may be mediated both by the glycosaminoglycan side chains and by the core protein itself. The classical case is the noncovalent binding of aggrecan to hyaluronan in cartilage (38). In PG-M/versican the N-terminal domain of the core protein exhibits hyaluronan-binding properties (39-41), whereas the C-terminal domain has lectin-like and heparin binding activity (19) and can bind to tenascin-R (42). The HMPG complexes, in addition to the PG-M/versican-like monomers, evidently contain some other component to account for their lower buoyant density (1.42 g/ml; Fig. 1) compared with that of the monomers (1.48 g/ml; Fig. 2). In the previous study (32), it was shown that the integrity of the large HMPG complexes is resistant to treatment with strong chaotropic agent (6 M guanidine) but susceptible to reduction and alkylation. This suggested that the HMPG complexes, unlike aggregates with hyaluronan, are covalently held together by intermolecular disulfide bonds. Due to the low pH of the extraction buffer (pH 5.8) and the presence of the alkylating agent NEM, it appears unlikely that the PG complexes could be artificially formed by disulfide exchange during extraction rather than being the natural molecular organization in the embryonic extracellular matrix. In further support of this conclusion, the HMPG fraction has been found to have a very low relative protein content.5 In the subepidermal matrix of the axolotl embryo, PGs appear to be localized along collagen fibrils, seemingly attached to them (27-30). Moreover, chicken PG-M has been shown to be able to bind to type I collagen (39). However, neither the size nor the buoyant density of HMPGs were altered by collagenase treatment, arguing against the possibility that the isolated HMPG complexes may owe their size (and buoyant density) to their association with collagen. Furthermore, since hyaluronidase treatment was also ineffective in dissociating the complexes, the present study rules out that any binding to hyaluronan could be involved in creating the large size of the complexes. Hyaluronan binding activity was demonstrated for the IMPGs (Fig. 5) but not for the HMPG complexes (Fig. 4). Although the intact complexes seem to be unable to bind to hyaluronan under the present experimental conditions, it cannot be precluded that the native monomers might have the capacity to do so. The protein-protein interactions leading to intermolecular disulfide bridges could, for instance, obscure the recognition sites for hyaluronan. Nevertheless, since the PG-M/versican-like PGs apparently form large supramolecular complexes by protein-protein interaction, the aggregation with hyaluronan may have been rendered redundant in the axolotl embryo. Whether the complex formation is compatible with a role for PG-M/versican in bridging cell surfaces to pericellular hyaluronan (40), or in cell attachment-inhibitory binding to cell surface hyaluronan (7), remains to investigate.

It is not known whether the ability to form intermolecular disulfide bonds may be unique to the axolotl variant of PG-M/versican or if it may be a general feature of some specific splice variant. When the structure of bovine PG-M/versican was investigated in the transmission electron microscope with the glycerol spraying/rotary shadowing technique (43), a pronounced tendency for these PGs to self-aggregate was noted. By that technique, however, it could not be judged whether covalent intermolecular bonds were involved in stabilizing the aggregates. Accordingly, it remains to be studied whether PG-M/versican-like PGs exist in the form of large disulfide-stabilized PG complexes in other systems. Intriguingly, PG-1000/TAP-1, a large PG component of disulfide-stabilized complexes associated with the electric organ basement membranes of electric rays (44-45), might be related to the PG-M/versicans. Very large CS/DSPGs, which like the HMPGs of the axolotl embryo elute in the void volume in Sepharose CL-2B chromatography under dissociative conditions, have previously been isolated from sea urchin embryos (46-47). However, it remains unknown whether the sea urchin PGs owe their large size to complex formation or to the presence of exceedingly large CS/DS side chains (47). Although the molecular identity of the large sea urchin PGs has not yet been reported, the dependence on these molecules for the migration of primary mesenchyme cells during sea urchin development (47-49) is intriguing.

Previously, bovine aggrecan was found to inhibit axolotl neural crest cell migration in vitro (6-7), whereas aggrecans, when coated onto microcarriers and introduced into the migratory pathways of axolotl embryos (50), affected neural crest cells differently depending on what species the PGs were obtained. The choice of model PG for the study of neural crest cell migration in the axolotl embryo may thus be crucial. Since ample purification of PGs from axolotl embryos is not readily feasible, it is presently difficult to directly address the question whether the large PG-M/versican complexes affect migration in the embryo. Such studies may have to await the identification of all components in the complexes so that these may be assembled from components expressed and purified from other sources or the development of gene targeting techniques in the axolotl.


FOOTNOTES

*   This work was supported by Grant 6525 from the Swedish Medical Research Council, Konung Gustaf V:s 80-Årsfond, and the Swedish Natural Science Research Council Grant B-AA/BU 03810-311. The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
Dagger    To whom correspondence should be addressed: Dept. of Veterinary Medical Chemistry, SLU, BMC, Box 575, S-751 23 Uppsala, Sweden. Tel.: +46-18-174276; Fax: +46-18-550762; E-mail: michael.stigson{at}vmk.slu.se.
1    The abbreviations used are: PG, proteoglycan; HMPG, high molecular weight PG; IMPG, intermediate molecular weight PG; CS, chondroitin sulfate; DS, dermatan sulfate; AxPG, axolotl proteoglycan; GST, glutathione S-transferase; PAGE, polyacrylamide gel electrophoresis; PBS, phosphate-buffered saline; NEM, N-ethylmaleimide.
2    Currently, an axolotl PG (AxPG) with homology to PG-M/versican is being cloned (M. Stigson and L. Kjellén, work in progress). Briefly, a cDNA probe corresponding to a portion of the conserved C-terminal domain of chicken PG-M (22) prepared from a partial cDNA clone generously provided by Drs. K. Kimata and T. Shinomura was used for the screening of an oligo(dT)-primed embryonic axolotl cDNA library. A 4.67-kilobase pair AxPG partial cDNA clone (the full transcript was estimated by Northern analysis to be around 12-13 kilobase pairs) was sequenced and found to consist of 3422 of coding and 1245 base pairs of 3'-untranslated sequence. The deduced amino acid sequence comprises the C-terminal 1140 amino acid residues of the core protein including 830 amino acid residues of the CS attachment domain and the complete conserved C-terminal end with two epidermal growth factor-like domains, a lectin-like domain, and a complement regulatory protein-like domain. The C-terminal domain of AxPG shows an extensive amino acid sequence identity to that of the published chicken (22), mouse (24), and human (51) PG-M/versican, i.e. 83% identity to the avian and 78% to the mammalian species, whereas the similarity to other large PGs is significantly lower, e.g. 58% identity to chicken aggrecan (52) and 56% to rat neurocan (53). However, the CS attachment region apparently shows limited sequence conservation between the species and was chosen for expression as a fusion protein and generation of AxPG-specific antibodies (cf. 54).
3    Introducing ion exchange chromatography on DEAE-Sephacel as a first step before Sepharose CL-2B chromatography or CsCl gradient centrifugation was found to result in a significantly reduced recovery of HMPGs compared with IMPGs (M. Stigson, unpublished data). For unknown reasons, HMPGs appear to bind irreversibly to the ion exchange resin and are only partly eluted by increasing the salt concentration. This property of the HMPG was taken advantage of for purification of IMPGs, which were enriched after ion exchange chromatography of HMPG-contaminated IMPG preparations.
4    Since the buoyant density of the HMPG monomers is lower, 1.48 g/ml (Fig. 2) versus 1.55 g/ml (Fig. 1) for IMPG, while their glycosaminoglycan side chains are longer, Mr approx 150,000 versus Mr approx  75,000 for IMPG (Fig. 3), HMPG is likely to have fewer side chains per core protein molecule than IMPG. Nevertheless, the immunoreactivity of IMPGs to anti-CS-stub antibodies was found to be lower than for the HMPGs when equal amounts of 35S radioactivity of purified PGs were analyzed by slot blotting (Fig. 6). A restricted access of primary antibodies due to a relative epitope clustering could account for the lower immunoreactivity of IMPG.
5    When epidermal explants were simultaneously labeled with [3H]leucine and [35S]sulfate (M. Stigson, unpublished data) and analyzed by chromatography on Sepharose CL-2B, essentially all 3H-labeled macromolecules of the epidermal explants eluted with Kav approx 0.8, whereas <1% of the 3H radioactivity was recovered in the void volume. The low protein content of the HMPG fraction did not allow for further characterization of its protein component.

Acknowledgments

We express our gratitude to Drs. Koji Kimata and Tamayuki Shinomura for their generous gift of chicken PG-M cDNA and to Sandra Borland at the Indiana University Axolotl Colony, Bloomington, IN, for patiently providing embryos. We are grateful to Dr. Staffan Johansson for oligonucleotide synthesis, helpful discussion, and critical reading of the manuscript. We thank Inger Eriksson, Britt-Marie Fogelholm, and Charlotte Fällström for technical assistance.


REFERENCES

  1. Ruoslahti, E. (1988) Annu. Rev. Cell Biol. 4, 229-255 [CrossRef]
  2. Toole, B. P. (1991) in Cell Biology of the Extracellular Matrix (Hay, E. D., ed), 2nd Ed., pp. 305-341, Plenum Publishing Corp., New York
  3. Wight, T. N., Kinsella, M. G., and Qwarnström, E. E. (1992) Curr. Opin. Cell Biol. 4, 793-801 [CrossRef][Medline] [Order article via Infotrieve]
  4. Kinsella, M. G., and Wight, T. N. (1986) J. Cell Biol. 102, 679-687 [Abstract/Free Full Text]
  5. Funderburg, F. M., and Markwald, R. R. (1986) J. Cell Biol. 103, 2475-2487 [Abstract/Free Full Text]
  6. Perris, R., and Johansson, S. (1987) J. Cell Biol. 105, 2511-2521 [Abstract/Free Full Text]
  7. Perris, R., and Johansson, S. (1990) Dev. Biol. 137, 1-12 [CrossRef][Medline] [Order article via Infotrieve]
  8. Morriss-Kay, G., and Tuckett, F. (1989) Development 106, 787-798 [Abstract/Free Full Text]
  9. Yamagata, M., Suzuki, S., Akiyama, S. K., Yamada, K. M., and Kimata, K. (1989) J. Biol. Chem. 264, 8012-8018 [Abstract/Free Full Text]
  10. Yamagata, M., Shinomura, T., and Kimata, K. (1993) Anat. Embryol. 187, 433-444 [Medline] [Order article via Infotrieve]
  11. Yamagata, M., Saga, S., Kato, M., Bernfield, M., and Kimata, K. (1993) J. Cell Sci. 106, 55-65 [Abstract]
  12. Yamagata, M., and Kimata, K. (1994) J. Cell Sci. 197, 2581-2590
  13. Faissner, A., Celement, A., Lochter, A., Streit, A., Mandl, C., and Schachner, M. (1994) J. Cell Biol. 126, 783-799 [Abstract/Free Full Text]
  14. Braunewell, K.-H., Martini, R., LeBaron, R., Kresse, H., Faissner, A., Schmitz, B., and Schachner, M. (1995) Eur. J. Neurosci. 7, 792-804 [CrossRef][Medline] [Order article via Infotrieve]
  15. Braunewell, K.-H., Pesheva, P., McCarthy, J. B., Furcht, L. T., Schmitz, B., and Schachner, M. (1995) Eur. J. Neurosci. 7, 805-814 [CrossRef][Medline] [Order article via Infotrieve]
  16. Heyman, I., Faissner, A., and Lumsden, A. (1995) Dev. Dyn. 204, 301-315 [Medline] [Order article via Infotrieve]
  17. Landholt, R. M., Vaughan, L., Winterhalter, K. H., and Zimmermann, D. R. (1995) Development 121, 2303-2312 [Abstract]
  18. Ernst, H., Zanin, K. B., Everman, D., and Hoffman, S. (1995) J. Cell Sci. 108, 3807-3816 [Abstract]
  19. Ujita, M., Shinomura, T., Ito, K., Kitagawa, Y., and Kimata, K. (1994) J. Biol. Chem. 269, 27603-27609 [Abstract/Free Full Text]
  20. Sugiura, N., Sakurai, K., Hori, Y., Karasawa, K., Suzuki, S., and Kimata, K. (1993) J. Biol. Chem. 268, 15779-15787 [Abstract/Free Full Text]
  21. Kjellén, L., and Lindahl, U. (1991) Annu. Rev. Biochem. 60, 443-475 [CrossRef][Medline] [Order article via Infotrieve]
  22. Shinomura, T., Nishida, Y., Ito, K., and Kimata, K. (1993) J. Biol. Chem. 268, 14461-14469 [Abstract/Free Full Text]
  23. Dours-Zimmermann, M. T., and Zimmermann, D. R. (1994) J. Biol. Chem. 269, 32992-32998 [Abstract/Free Full Text]
  24. Ito, K., Shinomura, T., Zako, M., Ujita, M., and Kimata, K. (1995) J. Biol. Chem. 270, 958-965 [Abstract/Free Full Text]
  25. Shinomura, T., Zako, M., Ito, K., Ujita, M., and Kimata, K. (1995) J. Biol. Chem. 270, 10328-10333 [Abstract/Free Full Text]
  26. Löfberg, J., Nynäs-McCoy, A., Olsson, C., Jönsson, L., and Perris, R. (1985) Dev. Biol. 107, 442-459 [CrossRef][Medline] [Order article via Infotrieve]
  27. Spieth, J., and Keller, R. E. (1984) J. Exp. Zool. 229, 91-107 [CrossRef][Medline] [Order article via Infotrieve]
  28. Löfberg, J., Epperlein, H. H., Perris, R., and Stigson, M. (1989) in Developmental Biology of the Axolotl (Armstrong, J. B., and Malacinski, G. M., eds), pp. 83-101, Oxford University Press, New York
  29. Löfberg, J., Perris, R., and Epperlein, H. H. (1989) Dev. Biol. 131, 168-181 [Medline] [Order article via Infotrieve]
  30. Perris, R., Löfberg, J., Fällström, C., von Boxberg, Y., Olsson, L., and Newgreen, D. F. (1990) Development 109, 533-551 [Abstract]
  31. Keller, R. E., Löfberg, J., and Spieth, J. (1982) Dev. Biol. 89, 179-195 [CrossRef][Medline] [Order article via Infotrieve]
  32. Stigson, M., and Kjellén, L. (1991) Arch. Biochem. Biophys. 290, 391-396 [CrossRef][Medline] [Order article via Infotrieve]
  33. Zackson, S. L., and Steinberg, M. S. (1986) Dev. Biol. 117, 342-353 [CrossRef][Medline] [Order article via Infotrieve]
  34. Bordzilovskaya, N. P., Detlaff, T. A., Duhon, S. T., and Malacinski, G. M. (1989) in Developmental Biology of the Axolotl (Armstrong, J. B., and Malacinski, G. M., eds), pp. 201-219, Oxford University Press, New York
  35. Heinegård, D., and Sommarin, Y. (1987) Methods Enzymol. 144, 319-372 [Medline] [Order article via Infotrieve]
  36. Bitter, T., and Muir, H. M. (1962) Anal. Biochem. 4, 330-334 [CrossRef][Medline] [Order article via Infotrieve]
  37. Couchman, J. R., Caterson, B., Christner, J. E., and Baker, J. E. (1984) Nature 307, 650-652 [CrossRef][Medline] [Order article via Infotrieve]
  38. Hardingham, T. E., and Muir, H. (1972) Biochim. Biophys. Acta 279, 401-405 [Medline] [Order article via Infotrieve]
  39. Yamagata, M., Yamada, K. M., Yoneda, M., Suzuki, S., and Kimata, K. (1986) J. Biol. Chem. 261, 13526-13535 [Abstract/Free Full Text]
  40. LeBaron, R. G., Zimmermann, D. R., and Ruoslahti, E. (1992) J. Biol. Chem. 267, 10003-10010 [Abstract/Free Full Text]
  41. Margolis, R. U., and Margolis, R. K. (1994) Methods Enzymol. 245, 105-126 [Medline] [Order article via Infotrieve]
  42. Aspberg, A., Binkert, C., and Ruoslahti, E. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 10590-10594 [Abstract/Free Full Text]
  43. Mörgelin, M., Paulsson, M., Malmström, A., and Heinegård, D. (1989) J. Biol. Chem. 264, 12080-12090 [Abstract/Free Full Text]
  44. Carlson, S. S., and Wight, T. N. (1987) J. Cell Biol. 105, 3075-3086 [Abstract/Free Full Text]
  45. Iwata, M., and Carlson, S. S. (1991) J. Biol. Chem. 266, 323-333 [Abstract/Free Full Text]
  46. Solursh, M., and Katow, H. (1982) Dev. Biol. 94, 326-336 [CrossRef][Medline] [Order article via Infotrieve]
  47. Solursh, M., Mitchell, S. L., and Katow, H. (1986) Dev. Biol. 118, 325-332 [CrossRef][Medline] [Order article via Infotrieve]
  48. Lane, M. C., and Solursh, M. (1988) Dev. Biol. 127, 78-87 [CrossRef][Medline] [Order article via Infotrieve]
  49. Lane, M. C., and Solursh, M. (1991) Dev. Biol. 143, 389-397 [CrossRef][Medline] [Order article via Infotrieve]
  50. Olsson, L., Svensson, K., and Perris, R. (1996) Pigment Cell Res. 9, 18-27 [CrossRef][Medline] [Order article via Infotrieve]
  51. Zimmermann, D. R., and Ruoslahti, E. (1989) EMBO J. 8, 2975-2981 [Medline] [Order article via Infotrieve]
  52. Li, H., Schwartz, N. B., and Vertel, B. M. (1993) J. Biol. Chem. 268, 23504-23511 [Abstract/Free Full Text]
  53. Rauch, U., Karthikeyan, L., Maurel, P., Margolis, R. U., and Margolis, R. K. (1992) J. Biol. Chem. 267, 19536-19547 [Abstract/Free Full Text]
  54. Zimmermann, D. R., Dours-Zimmermann, M. T., Schubert, M., and Bruckner-Tuderman, L. (1994) J. Cell Biol. 124, 817-825 [Abstract/Free Full Text]

©1997 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
J. Biol. Chem.Home page
S. Cattaruzza, M. Schiappacassi, A. Ljungberg-Rose, P. Spessotto, D. Perissinotto, M. Morgelin, M. T. Mucignat, A. Colombatti, and R. Perris
Distribution of PG-M/Versican Variants in Human Tissues and de Novo Expression of Isoform V3 upon Endothelial Cell Activation, Migration, and Neoangiogenesis in Vitro
J. Biol. Chem., November 27, 2002; 277(49): 47626 - 47635.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Wu, L. Chen, P.-S. Zheng, and B. B. Yang
beta 1-Integrin-mediated Glioma Cell Adhesion and Free Radical-induced Apoptosis Are Regulated by Binding to a C-terminal Domain of PG-M/Versican
J. Biol. Chem., March 29, 2002; 277(14): 12294 - 12301.
[Abstract] [Full Text] [PDF]


Home page
DevelopmentHome page
D Perissinotto, P Iacopetti, I Bellina, R Doliana, A Colombatti, Z Pettway, M Bronner-Fraser, T Shinomura, K Kimata, M Morgelin, et al.
Avian neural crest cell migration is diversely regulated by the two major hyaluronan-binding proteoglycans PG-M/versican and aggrecan
Development, January 7, 2000; 127(13): 2823 - 2842.
[Abstract] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Stigson, M.
Right arrow Articles by Kjellén, L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Stigson, M.
Right arrow Articles by Kjellén, L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1997 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement