JBC PeproTech; Our Business is Cytokines!

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Wang, Y.
Right arrow Articles by Spellman, M. W.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Wang, Y.
Right arrow Articles by Spellman, M. W.

J Biol Chem, Vol. 273, Issue 14, 8112-8118, April 3, 1998

Purification and Characterization of a GDP-fucose:Polypeptide Fucosyltransferase from Chinese Hamster Ovary Cells*

Yang Wang and Michael W. SpellmanDagger

From the Department of Pharmacokinetics and Metabolism, Genentech, Inc., South San Francisco, California 94080

    ABSTRACT
Top
Abstract
Introduction
Procedures
Results
Discussion
References

A GDP-fucose:polypeptide fucosyltransferase was purified 5000-fold to homogeneity from Chinese hamster ovary cell extracts in the absence of detergent. The purification procedure included two affinity chromatographic steps using the acceptor substrate, a recombinant factor VII EGF-1 domain, and the donor substrate analog, GDP-hexanolamine, as ligands. The purified enzyme migrates as a single band of 44,000 daltons on SDS-polyacrylamide gel electrophoresis and is itself a glycoprotein with more than one high mannose type oligosaccharide chain with a total molecular weight of 4000. The Km values for factor VII EGF-1 domain and GDP-fucose are 15 and 6 µM, respectively. The Vmax is 2.5 µmol·min-1·mg-1. The presence of 50 mM Mn2+ increased the enzyme activity 17-fold, but Mn2+ was not absolutely required, since the enzyme exhibited some activity even in the presence of EDTA. The acceptor substrate specificity was studied using site-directed mutagenesis of human factor IX EGF domain. Only one of several differently folded species could serve as acceptor substrate, although they all had the same molecular weight as determined by liquid chromatography on-line with mass spectrometry. This indicates that the enzyme requires proper folding of the epidermal growth factor domain for its activity.

    INTRODUCTION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

The identification of O-linked fucose attached to a specific protein was first made by Kentzer et al. (1), who found a residue of fucose covalently linked through an O-glycosidic bond to the EGF1 domain of recombinant urokinase. The same modification was later identified to be on tissue plasminogen activator (2), human factor VII (3), human factor XII (4), and a plasminogen activator from the saliva of a vampire bat (5). Similar fucosylation was also shown to occur on the EGF domain of human factor IX (6), but in this case the fucose residue was at the reducing end of a tetrasaccharide: NeuAcalpha 2right-arrow6Galbeta 1right-arrow4GlcNAcbeta 1right-arrow3Fucalpha 1right-arrowO-Ser61 (7). In all cases described above, the attachment of O-linked fucose to serine or threonine was found to occur on EGF domains within the sequence Cys-Xaa-Xaa-Gly-Gly-Ser/Thr-Cys (8).

Although all examples of mammalian O-fucosylation characterized to date have been modifications of EGF domains (8), it is possible that O-linked fucosylation occurs in non-EGF-containing proteins. Studies by two other laboratories using the lec1 mutant cell line indicated that O-fucosylation occurs on many proteins in Chinese hamster ovary cells (9, 10). These studies were not performed in a manner that would enable EGF domain-containing proteins to be distinguished from those without EGF domains. Structural analysis has also revealed that O-linked fucose is present on an insect protease inhibitor (11), although the flanking amino acids were not represented by the consensus sequence described above, and the protease inhibitor sequence is not homologous to an EGF domain.

We have focused our research mainly on the biosynthesis of this post-translational modification. Recently, we reported the development of an assay for the GDP-L-fucose:polypeptide fucosyltransferase, which catalyzes the attachment of fucose through an O-glycosidic linkage to the conserved serine or threonine residue in EGF domains (12). The assay uses a recombinant human factor VII EGF-1 domain as acceptor substrate and GDP-fucose as donor substrate. Using this assay, we were able to detect activity in extracts of Chinese hamster ovary cells and rat liver. In addition, when rat liver was homogenized in the presence of protease inhibitors, 37% of the activity was recovered by Triton X-100 extraction of the membrane particles after extensive aqueous washes. These results suggest that the enzyme is probably a membrane protein and, by analogy with other glycosyltransferases, probably has a "stem" region that is very susceptible to proteolysis (13).

In this paper, we report the purification of this O-fucosyltransferase to apparent homogeneity. This study also includes the initial characterization of the purified enzyme and its acceptor substrate specificity.

    EXPERIMENTAL PROCEDURES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

O-Fucosyltransferase Assay

The assay procedure was essentially the same as described previously (12). The reaction mixture (50 µl) contained 0.1 M imidazole-HCl, pH 7.0, 50 mM MnCl2, 0.1 mM of GDP-[14C]fucose (4000-8000 cpm/nmol), 20 µM recombinant human factor VII EGF-1 domain, and enzyme preparations typically containing 0.01-0.1 milliunit of activity. The mixture was incubated at 37 °C typically for 15 min. The reaction was stopped by placing the mixture on ice and then diluting with 950 µl of 0.25 M EDTA, pH 8.0. Separation of incorporated fucose from GDP-fucose, fucose-phosphate, and free fucose was carried out by passing the solution through a C18 cartridge (Alltech, Extract Clean, C18, 200 mg). The cartridge was washed with 5 ml of H2O, and the product was then eluted with 3 ml of 80% acetonitrile containing 0.052% trifluoroacetic acid. The eluant was mixed with 10 ml of Aquasol II (NEN Life Science Products) and counted using a liquid scintillation counter.

Recombinant Human Factor VII and IX EGF Domains and Mutants

The recombinant forms of human factor VII EGF-1 domain used for assays and affinity chromatography were prepared as described previously (12). The construction of human factor IX EGF domain and its mutant genes were the same as for factor VII EGF-1 domain. The sequence of factor IX EGF domain was taken from residues 45-87 of the mature protein, with six histidine residues attached at carboxyl terminus of the sequence followed by three residues from the vector, YVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTHHHHHHGSA. The potential glycosylation site is underlined. The gene encoding factor IX EGF domain without the polyhistidine sequence was made first by annealing primers designed to form oligonucleotide cassettes as listed in Table I, using standard molecular biology techniques (14). The gene was then cloned into the MluI and BamHI sites of a phagemid vector, pA4G32 (15), previously developed for bacteriophage display. The recombinant phagemid, pF9EGF, contained the alkaline phosphatase promoter and the bacterial stII signal sequence upstream of the gene encoding the EGF domain as well as the beta -lactamase gene as a selectable marker. The construction of the gene for factor IX EGF domain with a polyhistidine tag, pF9EGF-His6, was made by replacing part of the COOH-terminal sequence with another oligonucleotide cassette containing the polyhistidine sequence, utilizing the restriction sites SstI and BamHI as shown in Table I. The mutants were constructed using the similar oligonucleotide cassettes with mutated sequences. The plasmids were then transformed into Escherichia coli strain 27C7 by electroporation. Expression of the proteins was carried out in 1 liter of AP minimum medium, at 37 °C overnight. The recombinant EGF domains were purified from periplasmic shockates using Ni2+-NTA-agarose (Qiagen) according to the manufacturer's instruction for nondenaturing purification. For 1 liter of culture fluid, 0.5 ml of resin was used, and the eluant was then concentrated in a Centricon-3 (Amicon) to about 200 µl and used for subsequent experiments.

                              
View this table:
[in this window]
[in a new window]
 
Table I
Oligonucleotide sequences used to generate cassettes encoding human factor IX EGF domain
Cassette f9egfh6 was used to generate a polyhistidine tag at the carboxyl terminus of the EGF domain by replacing the underlined part of cassette 3. 

Cell Culture Method

Suspension culture of Chinese hamster ovary cells was maintained in serum-free Ham's F12/DMEM (50:50) media, supplemented with insulin, putrescine, selenium, ferrous sulfate, and polyvinyl alcohol, in a 40-liter bio-reactor. The cells were harvested when the density reached 3.4 × 106 cells/ml, 98% viable, using a centrifugation method. The collected cell paste was frozen at -70 °C and used for purification of the O-fucosyltransferase without further treatment.

Purification

Buffer A was 25 mM imidazole-HCl, pH 7.0. Buffer B was 25 mM Tris-HCl, pH 8.0, 25 mM NaCl, and 25%(w/v) glycerol. Buffer C was 25 mM Tris-HCl, pH 8.0, 25 mM NaCl, 25% (w/v) glycerol, 1 mM MnCl2, and 0.1 mM GDP. Buffer D was 25 mM imidazole-HCl, pH 7.0, 25 mM NaCl, and 25% (w/v) glycerol. Buffer E was 25 mM imidazole-HCl, pH 7.0, 25 mM NaCl, 5 mM MnCl2, and 25% (w/v) glycerol.

Step 1: Preparation of Chinese Hamster Ovary Cell Extract-- Frozen Chinese hamster ovary cell paste (100 g) was thawed at room temperature and kept on ice. The cells were homogenized by sonication (Virsonic 550, at 20% output with a 1/2-inch probe) with three 30-s bursts in 300 ml of buffer A containing 25 mM NaCl. DNase I (2 mg/ml, 1 ml) and MgCl2 (1 M, 0.4 ml) were added to the homogenate, which was then centrifuged at 10,000 × g (Sorvall RC-5, GSA rotor) for 45 min. The supernatant (355 ml) was used for further purification.

Step 2: DE-52 and Affi-Gel Blue Chromatography-- Two columns, DE-52 (Whatman, 2.5 × 30 cm) and Affi-Gel Blue (Bio-Rad, 2.5 × 15 cm), were connected in series and equilibrated with buffer A containing 25 mM NaCl. The supernatant from the previous step was loaded onto the DE-52 column (1 ml/min), and the columns were washed with 500 ml of the same buffer. The DE-52 column was then detached from the Affi-Gel Blue column. The latter was washed with 200 ml buffer of buffer A containing 125 mM NaCl and followed by 400 ml of high salt (buffer A with 1 M NaCl) elution. The eluted fractions containing enzyme activity were pooled and dialyzed against buffer B. The final volume was 40 ml.

Step 3: Factor VII EGF-1-His6-Ni2+-NTA-Agarose-- The affinity resin with the acceptor substrate as ligand was made by mixing 6 mg of factor VII EGF-1-His6 with 10 ml of Ni2+-NTA-agarose resin in 0.1 M Tris-HCl, pH 8.0, for 4 h at 4 °C. The resin was then packed into a column (1.5 × 6 cm) and washed with 40 ml of 0.1 M Tris-HCl, pH 8.0, followed by another wash of 30 ml of 0.1 M Tris-HCl, 0.5 M NaCl. It was then equilibrated with the same buffer used for dialysis in the previous step.

The dialyzed sample was supplemented with 1 mM MnCl2 and 0.1 mM GDP (Sigma) and loaded onto the affinity column at a flow rate of 0.5 ml/min followed by 40 ml of buffer C. The column was then washed with 45 ml of buffer C containing 0.5 M NaCl and 45 ml of buffer D, respectively. The enzyme was then eluted off the column with 90 ml of 0.3 M imidazole-HCl, pH 7.0, 25% (w/v) glycerol. The fractions containing activity were pooled and dialyzed against buffer D and ready for the next step.

Step 4: GDP-hexanolamine-Agarose-- The affinity resin with donor substrate analog as ligand was made by coupling GDP-hexanolamine (30 µmol, provided by Dr. R. L. Hill, Duke University) to CNBr-activated Sepharose 4B resin (10 ml, Amersham Pharmacia Biotech) according to the manufacturer's instructions. The resin was then packed in a column (inner diameter, 1.5 cm) and equilibrated with buffer F.

The dialyzed sample (13 ml) was supplemented with 5 mM MnCl2 and loaded onto the column at 5 ml/h. The column was then washed with 30 ml of buffer E, followed by 45 ml of the same buffer with 125 mM NaCl and then another 10 ml of buffer E. The elution was carried out by using a linear gradient from 0-2 mM GDP; it started with 100% of buffer E and finished with 100% of buffer E containing 2 mM GDP in a total volume of 50 ml. The column was washed with another 40 ml of the latter buffer. Fractions containing activity were first examined by silver-stained SDS-PAGE, and those with only a single band (44,000 Da) were pooled. Glycerol was added to a final concentration of 50% (w/v) for storage at -20 °C.

Step 5: Gel Filtration Removal of Recombinant Factor VII EGF-1-His6-- The flow-through fractions containing enzyme activity from the first GDP-hexanolamine-agarose chromatography were pooled (14 ml total). A column (2.5 × 20 cm) of Sephadex G-50 fine was equilibrated and run with buffer B at a flow rate of 15 ml/h. Half of the pooled sample was loaded at a time, and the column effluent was monitored for absorbance at 280 nm. Two well separated peaks were identified. Reverse phase HPLC analysis of the fractions within the second peak determined that it mainly contained factor VII EGF-1-His6. The fractions within the first peak were then pooled, supplemented with 5 mM MnCl2, and loaded onto the GDP-hexanolamine-agarose column as described above.

Glycosidase Digestion of the Purified O-Fucosyltransferase

PNGase F Digestion-- Pure protein in storage buffer (0.4 µg, 50 µl) was first precipitated with 250 µl of acetone at -20 °C for 30 min and was then spun in a microcentrifuge for 15 min. The pellet was washed with 200 µl of acetone and air-dried. The protein was then redissolved in 10 µl of 0.5% SDS, 10 mM beta -mercaptoethanol and 0.15 M Tris-HCl, pH 8.0, and heated at 100 °C for 3 min. The digestion was carried out by adding 0.5 unit of PNGase F (Boehringer Mannheim) in 20 µl of 2% Nonidet P-40, 30 mM EDTA, pH 8.0, to the denatured protein mix, and the solution was incubated at 37 °C overnight. The digested sample (10 µl) was directly analyzed by SDS-PAGE.

Endoglycosidase H Digestion-- The protein was denatured as described above. Digestion was carried out with 1 milliunit of endoglycosidase H (Boehringer Mannheim) in 30 µl of 50 mM sodium citrate, pH 5.5, 2 mM phenylmethylsulfonyl fluoride, 0.25% Nonidet P-40 at 37 °C for 4.5 h. An aliquot (10 µl) of the sample was analyzed by SDS-PAGE.

Kinetic Characterization of the Purified O-Fucosyltransferase

Assays for measuring Km and Vmax were carried out essentially as described above except with variations in substrate concentrations. The amount of enzyme applied was limited to give no more than 10% conversion of substrate to product to obtain accurate initial reaction rates. Km and Vmax were calculated from duplicate data points using double reciprocal plots.

The pH optimum of the purified enzyme was determined by performing the assays in 0.1 M solutions of the following buffers: sodium acetate, pH 4.5, 4.7, 4.9, 5.1, 5.3, and 5.5; sodium cacodylate, pH 5.5, 5.7, 5.9, 6.1, 6.3, and 6.5; imidazole-HCl, pH 6.5, 6.7, 6.9, 7.1, 7.3, and 7.5; Tris-HCl, pH 7.5, 7.7, 7.9, 8.1, 8.3, and 8.5; and sodium borate, pH 8.5, 8.7, 8.9, 9.1, 9.3, and 9.5.

The metal ion requirement of the purified enzyme was examined by performing the assays in a 50 mM solution of various divalent metal ions or 25 mM EDTA. Excess manganese ion present in the purified enzyme preparation was removed using gel filtration chromatography (NAP-5 column, Amersham Pharmacia Biotech, according to the manufacturer's procedure).

Reverse Phase HPLC and Electrospray Mass Spectrometry

HPLC-MS analyses were performed on a Hewlett-Packard 1090 liquid chromatography system interfaced with a Perkin-Elmer/Sciex AP-300 triple quadrupole mass spectrometer. Separations were carried out on a C-18 column (2.1 × 250 mm, Vydac), at a flow rate of 0.2 ml/min. Buffer A was 0.06% aqueous trifluoroacetic acid, and buffer B was 0.052% trifluoroacetic acid and 80% acetonitrile. The gradient had the following steps: 0-1 min, 2-10% B; 1-5 min, 10-25% B; 5-25 min, 25-35% B; and 25-30 min, 35-98% B. The column effluent was monitored at 214 nm for protein and subsequently introduced into the mass spectrometer through a 1:5 splitter upstream of a regular ion sprayer. The orifice potential was set at 50 V, and the ion spray potential was at 4700 V. Mass scans were performed from 400 to 2500 m/z with a step size of 0.5 atomic mass units and a dwell time of 0.1 ms. The data were analyzed using BioMultiView 1.2 (Perkin-Elmer/Sciex).

Electrophoretic Methods and Protein Assay

Polyacrylamide gel electrophoresis of proteins in sodium dodecyl sulfate was performed on 12% gel as described earlier (16). Protein concentrations were determined using the Lowry (17) or Amido Black (18) method.

    RESULTS
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Purification of O-Fucosyltransferase

We have reported previously the identification and development of an assay for the O-fucosyltransferase that modifies certain serine or threonine residues of proteins (12). During the course of that work, several properties of the enzyme were observed. Most of the enzyme activity was recovered in the soluble fraction of Chinese hamster ovary cell lysate. The activity did not bind to DE-52 anion exchange column but was quantitatively retained on Affi-Gel Blue resin. As described in our previous paper (12), the enzyme was enriched approximately 8-fold. The objective of the present study was the purification of this enzyme to homogeneity. The specifics of the purification were as follows.

The frozen Chinese hamster ovary cell paste was thawed at room temperature and kept at 4 °C afterward for the entire procedure. Low ionic strength buffer was used during homogenization to help break the cells, and DNase I was added to the homogenate to reduce its viscosity and facilitate the following chromatography steps. As shown in Table II, 86% of the activity was recovered after the first step, which achieved 2.2-fold purification.

                              
View this table:
[in this window]
[in a new window]
 
Table II
Summary of the purification of O-fucosyltransferase
Results are from one preparation of the enzyme using 100 g of Chinese hamster ovary cell paste. Chromatograms of steps 2-4 are given in Figs. 1-3, respectively. One unit corresponds to 1 µmol of fucose transferred per min under the conditions of the assay described under "Experimental Procedures."

Since preliminary experiments had demonstrated that the enzyme flowed through DE-52 at pH 7 and bound to Affi-Gel Blue, the two columns were connected in series for loading and initial washing steps. The DE-52 column was detached from the Affi-Gel Blue column after the initial wash (Fig. 1, point A). Some nonspecifically bound protein was eluted when the salt concentration was increased from 25 mM to 125 mM NaCl. The enzyme was then eluted with 1 M NaCl (Fig. 1, point B). The combined purification for the two columns was 7.3-fold with 70% yield. The total volume of the preparation was reduced from 350 to 40 ml.


View larger version (13K):
[in this window]
[in a new window]
 
Fig. 1.   DE-52/Affi-Gel Blue chromatography. Details are described under "Experimental Procedures." Closed circles represent protein concentration, and open diamonds are for enzyme activity. At point A, the DE-52 column was detached, and the Affi-Gel Blue column was washed with buffer containing 125 mM NaCl. Elution of the enzyme started at point B with buffer containing 1 M NaCl.

In efforts to further purify the O-fucosyltransferase, we determined that the enzyme had high affinity toward both its acceptor substrate, the recombinant EGF domain, and a donor substrate analog, GDP-hexanolamine. Hence, affinity resins were made with these two molecules as ligands.

The affinity resin with factor VII EGF-1 domain as ligand was made by taking advantage of the polyhistidine sequence originally designed for purification of the recombinant protein. The O-fucosyltransferase was found to bind to the resin better when the polyhistidine tag was at the carboxyl terminus of the EGF domain rather than at its amino terminus; hence, the former was used for the purification. The coupling of the EGF to Ni2+-NTA-agarose was almost quantitative, and the resin was very stable; no leakage of recombinant EGF domain was detected after extensive washes. As shown in Fig. 2, the binding of the O-fucosyltransferase activity to this affinity resin was quantitative. At point A, the column was washed with the buffer containing 0.5 M NaCl, and a large amount of nonspecifically bound protein was eluted. The binding of enzyme to the EGF domain was found to be strong enough to withstand 2 M NaCl. Because the association between the enzyme and the EGF domain was so strong, an alternative method of elution was used to avoid denaturing the enzyme. Since the linkage of EGF domain to Ni2+-NTA resin is noncovalent, the recovery of the enzyme activity was achieved by dissociating the EGF domain from the resin by using imidazole to displace the polyhistidine binding to the Ni2+-NTA-agarose. The column was washed at point B with buffer containing 25 mM imidazole to elute more nonspecifically bound protein. At point C, a solution of 0.3 M imidazole was used to elute the polyhistidine-tagged EGF domain together with the enzyme off the column. The step purification was actually significantly higher than 16-fold as stated in Table II, since there was almost 6 mg of recombinant factor VII EGF-1 domain present in the eluant.


View larger version (20K):
[in this window]
[in a new window]
 
Fig. 2.   Factor VII EGF-1-His6-Ni2+NTA-agarose chromatography. Open diamonds stand for enzyme activity, and closed circles represent protein concentration as monitored by absorbance at 280 nm. At points A and B, the column was washed with buffers containing 0.5 M NaCl and 25 mM imidazole, respectively. The enzyme and factor VII EGF domain were eluted together at point C with 0.3 M imidazole.

The pooled activity from the factor VII EGF-1 affinity purification step was applied to a column of GDP-hexanolamine-agarose (Fig. 3). Unexpectedly, at least half of the enzyme activity flowed through this column. Experiments examining this flow-through activity will be described below. At point A, the column was washed with buffer containing 125 mM NaCl to elute nonspecifically bound protein. Then a GDP gradient (0-2 mM) was used for specific elution of the enzyme (point B). The fractions collected contained very limited amounts of protein. SDS-PAGE with silver staining was used to assess the purity of the preparation as shown in Fig. 4. Only one band, with a molecular weight of 44,000, was visible on the gel. The variation of the band intensity also corresponded to that of the enzyme activity among different fractions.


View larger version (17K):
[in this window]
[in a new window]
 
Fig. 3.   GDP-hexanolamine-agarose chromatography. Closed circles represent protein concentration as monitored by absorbance at 280 nm. The open diamonds represent enzyme activity. The dashed line indicates the 0-2 mM GDP gradient used for elution (monitored at 280 nm; scale not shown). After the sample was loaded, the column was washed with equilibration buffer and equilibration buffer containing 125 mM NaCl (point A). The GDP gradient starts at point B.


View larger version (35K):
[in this window]
[in a new window]
 
Fig. 4.   Reduced SDS-PAGE of O-fucosyltransferase. Each lane shows the protein detected by silver stain in a fraction collected from the GDP-hexanolamine-agarose chromatography shown in Fig. 3.

As described above, approximately half of the enzyme activity was in the flow-through fractions of the GDP-hexanolamine-agarose column. Possible explanations for this observation included the following: 1) the binding capacity of the GDP-hexanolamine column had been exceeded; 2) the column had resolved different fucosyltransferase activities that had been co-purified throughout the EGF affinity column; and 3) the presence of a large molar excess of the recombinant factor VII EGF-1 domain had interfered with binding of the O-fucosyltransferase to the GDP-hexanolamine column. Of these possibilities, the first was very unlikely, since preliminary experiments performed in the absence of the factor VII EGF-1 domain showed that the resin had higher capacity than would be required to bind all of the fucosyltransferase activity in the sample. To examine the latter two possibilities, the flow-through fractions from the GDP-hexanolamine agarose column were pooled and loaded on a Sephadex G-50 column as described under "Experimental Procedures." Two protein peaks were identified. One was in the void volume and contained enzyme activity, presumably now in a 1:1 stoichiometry of enzyme and the recombinant factor VII EGF-1 domain; the other eluted later and consisted of the recombinant factor VII EGF-1 domain, as assessed by HPLC. The fractions of the first peak were pooled and rerun on the GDP-hexanolamine-agarose column using the conditions described above. All of the activity was now retained on the column. SDS-PAGE analysis of eluted fractions gave a single band with the same molecular weight (44,000) as had been observed with the bound fraction of the first run of the GDP-hexanolamine column. These results indicated that the presence of a large molar excess of the acceptor substrate had interfered with the efficiency of binding of the enzyme to the GDP-hexanolamine column and that the bound versus unbound fractions did not represent different enzymes or molecular forms.

The final purification of the enzyme was nearly 5000-fold (Table II). The combined enzyme activity from two GDP-hexanolamine-agarose runs gave a total purification yield of about 20%. The O-fucosyltransferase accounted for approximately 0.02% of total Chinese hamster ovary cell protein at the start of the purification.

Characterization of the Purified Enzyme

Glycosidase Digestion-- The nature of glycosylation on the purified O-fucosyltransferase was examined using two endoglycosidases, PNGase F and endoglycosidase H, as described under "Experimental Procedures." Fig. 5 shows that after PNGase F digestion, the molecular weight of the protein was reduced from 44,000 to 40,000 (lane 2), suggesting the presence of N-linked oligosaccharides. Digestion with endoglycosidase H gave rise to two bands (lane 3) of lower molecular weight than the undigested protein (lane 1). These results were consistent with the presence of more than one high mannose type oligosaccharide on the enzyme.


View larger version (21K):
[in this window]
[in a new window]
 
Fig. 5.   Glycosidase digestion of O-fucosyltransferase. The reactions were performed as described under "Experimental Procedures." Reduced samples were subjected to electrophoresis on a 12% gel with SDS. Lane 1 is from the control reaction without glycosidase. Lane 2 is the PNGase F digestion mixture, and lane 3 is the endoglycosidase H digestion mixture. The low molecular weight bands in lanes 2 and 3 are PNGase F and endoglycosidase H, respectively. The two outer lanes are molecular weight markers.

Kinetic Parameters and Enzymatic Properties-- The Km and Vmax for factor VII His6-EGF-1, factor VII EGF-1 and GDP-fucose were measured and are listed in Table III. The enzyme activity was inhibited at high concentrations (>15 µM) of recombinant factor VII EGF-1 domains (data not shown). The parameters for the EGF domains obtained here were calculated from data generated with acceptor substrate concentrations up to 8 µM, in which the initial rate increased linearly with substrate concentration. The presence of the six histidine residues at the amino terminus of the EGF domain did not have a significant effect on enzyme activity. Because of the acceptor substrate inhibition, two different concentrations of factor VII His6-EGF-1 were used to measure the parameters for GDP-fucose (Table III). As a consequence, the Vmax values obtained for GDP-fucose are much lower than the ones for the recombinant factor VII EGF-1 domain. Although the Km values for GDP-fucose did not change with different factor VII EGF-1 domain concentrations, the Vmax values decreased with the increased concentrations of the acceptor substrate. To understand the exact nature of the substrate inhibition, more detailed kinetic studies would be required.

                              
View this table:
[in this window]
[in a new window]
 
Table III
Km and Vmax of donor and acceptor substrates
The values listed were obtained from plots of 1/V versus 1/S.

The purified O-fucosyltransferase was active from pH 5.5 to pH 8.0. It exhibited the highest activity in cacodylate and imidazole buffers (data not shown). As listed in Fig. 6, the presence of Mn2+ and several other divalent ions could increase its activity. However, the purified enzyme was active without the addition of any divalent ions and even in the presence of 25 mM EDTA and, therefore, does not appear to require divalent metal ions for its activity. Several ions (Cu2+, Fe3+, and Zn2+) appeared to inhibit the enzyme activity.


View larger version (28K):
[in this window]
[in a new window]
 
Fig. 6.   Metal ion requirements of the O-fucosyltransferase. Assays were carried out as described under "Experimental Procedures" in the presence of 50 mM metal ions except for Hg2+, of which 25 mM was used. The sample labeled EDTA was run without exogenously added metal ions and in the presence of 25 mM EDTA.

The donor substrate specificity of the purified enzyme was examined by performing the assays using the following nucleotide sugars in place of GDP-fucose. They were GDP-mannose, UDP-glucose, UDP-N-acetylglucosamine, UDP-galactose, UDP-N-acetylgalactosamine, and UDP-xylose. No activity was observed in assays with these donor nucleotide sugars.

Acceptor Substrate Specificity-- As described previously (12), all examples of O-fucosylation on EGF domains characterized to date occur within the putative consensus sequence CXXGG(S/T)C. To determine if the two glycine residues are required for O-fucosylation, human factor IX EGF domain mutants were constructed as shown in Table IV. Three mutants were constructed using alanine to replace either or both glycine residues and tested as acceptor substrates for the purified O-fucosyltransferase. All four recombinant EGF domains were found to serve as acceptor substrates in the fucosyltransferase assay (Table IV), although the total amount of fucose incorporated varied from one construct to another. It appeared, therefore, that the two glycine residues are not absolutely required for activity.

                              
View this table:
[in this window]
[in a new window]
 
Table IV
Human factor IX EGF domain mutants
Factor IX EGF domain and its mutants were constructed and expressed as described under "Experimental Procedures." The sequences shown here are part of the consensus region for O-fucosylation of EGF domains. The two residues where changes were made are shown in boldface type. The glycosylation site is underlined. EGF(wt) is the wild type sequence. Their abilities to serve as substrates for O-fucosyltransferase are shown as fucose transferred under standard assay conditions.

Analysis of the recombinant factor IX EGF domains using reverse phase HPLC revealed that upon the change of glycine to alanine, the mutant EGF domains exhibited multiple peaks on the chromatograms, whereas the wild type had only one peak (Fig. 7). Further characterization of the different peaks using LC/MS showed that all peaks from each mutant had same molecular weight. The most likely explanation for this observation is that the multiple peaks represented the same protein with different pairing of disulfide linkages and, therefore, that the change of either of the two glycine residues had significant effect on folding of the EGF domains.


View larger version (15K):
[in this window]
[in a new window]
 
Fig. 7.   Reverse phase HPLC of factor IX EGF domain and its mutants. The recombinant proteins are listed in Table III. Chromatography was carried out as described under "Experimental Procedures." Peaks labeled with retention times are recombinant proteins as verified by electrospray mass spectrometry. In each chromatogram all labeled peaks have the same molecular weight.

To determine whether all the different forms of the mutants could serve as substrates for the O-fucosyltransferase, LC/MS was used to analyze reaction products after incubation with the enzyme and GDP-fucose. The results for all these mutants are summarized in Table V. In all these cases, only one of the multiple peaks observed with each mutant was found to be fucosylated, as indicated by a molecular weight increase of 146 mass units. We concluded from these results that only EGF domains with correctly paired disulfides are able to serve as acceptor substrates. Therefore, although the two glycine residues were not absolutely required for activity, their presence was important for the correct folding of the EGF domain. The wild type EGF domain was a better substrate at least partly because it was all folded into one form, whereas for the mutants, only a fraction of the proteins were able to serve as substrates. It should be noted that the activities listed in Table IV were not measurements of initial reaction rates. No attempts were made to compare the abilities of correctly folded mutants to serve as substrates. It should also be noted that the molecular weights listed in Table IV are from theoretical calculation and the values in Table V are from the experimental measurements. The 1-2-mass unit discrepancies were most likely from experiment and data processing error.

                              
View this table:
[in this window]
[in a new window]
 
Table V
LC/MS analysis of fucosylation of human factor IX EGF domain mutants
Peaks with retention time shift (as compared to Fig. 7) and mass increase appropriate for incorporation of fucose are underlined.

The combined results strongly suggested that the O-fucosyltransferase required its substrate to have the proper disulfide pairing. This conclusion is supported by our observation that reduced and S-carboxymethylated recombinant factor VII EGF-1 domain no longer serves as an acceptor substrate (data not shown) and is also consistent with earlier studies (12) in which short synthetic peptides derived from the EGF domain sequence were found to serve as poor acceptor substrates.

    DISCUSSION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

A GDP-fucose:polypeptide fucosyltransferase was purified to apparent homogeneity from Chinese hamster ovary cell extracts in the absence of detergent. Our previous study showed that the same enzyme in rat liver was probably a membrane-bound protein (12). Most of the glycosyltransferases studied to date are type II membrane proteins with a short cytoplasmic amino-terminal domain followed by a transmembrane sequence, a stem region very susceptible to proteolysis, and a large carboxyl-terminal catalytic domain that retains enzymatic activity in the absence of other domains (13). These glycosyltransferases are usually localized in endoplasmic reticulum or Golgi apparatus. It is likely that the protein obtained using the purification procedure described here is a truncated form of an originally membrane-bound enzyme. The fact that the purified O-fucosyltransferase was itself a glycoprotein with high mannose type oligosaccharide chains also supported this suggestion, since glycoproteins are usually membrane-bound or secretory proteins. The presence of mostly high mannose type oligosaccharides on O-fucosyltransferase suggests that it is probably localized in either the endoplasmic reticulum or cis-Golgi region (19).

The affinity resin made with recombinant factor VII EGF-1-His6 and Ni2+-NTA-agarose had several advantages over conventional covalent cross-linking. First, the EGF ligand was attached to the resin in a defined orientation, according to the position of the polyhistidine sequence. We observed that binding of the enzyme to the resin was more efficient when the polyhistidine tag was at the carboxyl terminus of factor VII EGF-1 domain; hence, this construct was used in the purification. Second, the binding of polyhistidine tag to Ni2+-NTA resin was stable under most conditions used for protein purification, but when necessary, it is possible to elute the protein with the ligand together under very mild conditions, such as imidazole or EDTA.

As described under "Results," the presence of an excess amount of EGF domain reduced the binding of O-fucosyltransferase to GDP-hexanolamine agarose, and high concentrations of the EGF domain inhibited the enzyme activity. Although a more detailed kinetic study would be needed to determine the exact nature of this substrate inhibition, the fact that 2 M NaCl failed to elute the enzyme off the EGF column suggests that the binding of EGF domain to O-fucosyltransferase has a very low dissociation constant. Therefore, high concentrations of the EGF domain may inhibit the interaction between GDP-fucose and the enzyme.

Preliminary studies of the acceptor substrate specificity of the purified O-fucosyltransferase revealed some unexpected properties. Although all of the EGF domain O-fucosylation characterized to date occurred within the putative consensus sequence CXXGG(S/T)C, the results presented here clearly showed that the two glycine residues are not absolutely required. Even a mutant in which both glycines were replaced by alanines was O-fucosylated. It is certainly possible that substitution of the glycine residues with amino acids other than alanine may abolish the O-fucosylation. For example, protein Z and protein C in which one of the glycines is replaced by asparagine and histidine, respectively, are not O-fucosylated (8). It is also reasonable to suggest that the enzyme may fucosylate sequences with amino acids other than glycine or alanine at the corresponding positions as long as they are properly folded. If this is true, the number of potential candidates for EGF domain O-fucosylation would increase substantially, although no such cases have been identified so far.

O-Fucosylation has also been reported on the insect protease inhibitor PMP-C peptide (11). This is the first report of O-fucosylation of a non-EGF structure. We have observed that a recombinantly expressed mature PMP-C peptide in E. coli failed to serve as an acceptor substrate for the purified enzyme.2 It is not known if a precursor of the PMP-C peptide would serve as substrate. It is also possible that the modification reported for the PMP-C peptide is the result of an insect O-fucosyltransferase with different acceptor substrate specificity from the mammalian enzyme.

This study showed that proper disulfide pairing of EGF domains is critical for them to serve as acceptor substrates for the O-fucosyltransferase. This is in contrast to the oligosaccharyl transferase (20) and the beta -1,4-GalNAc transferase (21), in which the specific peptide sequence, rather than a particular disulfide pairing or folding pattern, determines if the sites are glycosylated. The mechanism of the O-fucosyltransferase recognition of its substrates is not yet known. Further experiments involving changing the positions of the cysteine residues and their flanking sequence may give important insights to this question.

The experiments reported here also support the studies published previously by Stults and Cummings (9) and Maloney et al. (10), in which it was reported that many proteins from Chinese hamster ovary cells were modified with O-linked fucose. The amount of O-fucosyltransferase present in Chinese hamster ovary cells is about 0.02% of total protein, which is more than most of the glycosyltransferases studied to date. A GenBankTM search resulted in many proteins with the putative consensus sequence for O-fucosylation. It is possible that O-fucosylation could be a very common post-translational modification.

Purification of the O-fucosyltransferase permits further studies on structure and function of the enzyme and on the biological implications of O-fucosylation. We are currently isolating the gene encoding the enzyme and further characterizing the sequence or structure requirements of the acceptor substrates for the enzyme activity.

    ACKNOWLEDGEMENTS

We thank Geoffrey F. Lee for providing recombinant human factor VII EGF-1 domain, Hardayal Prashad for Chinese hamster ovary cells, and Professor Robert L. Hill of Duke University for GDP-hexanolamine. We also thank Reed Harris for helpful suggestions and insightful discussion during the course of this project.

    FOOTNOTES

* The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

Dagger To whom correspondence should be addressed. Tel.: 650-225-2044; Fax: 650-225-6452; E-mail: mws{at}gene.com.

1 The abbreviations used are: EGF, epidermal growth factor; PAGE, polyacrylamide gel electrophoresis; HPLC, high pressure liquid chromatography; NTA, nitrolotriacetic acid; LC/MS, liquid chromatography on-line with mass spectrometry; PMP-C, Pars intercerebralis major peptide C.

2 Y. Wang and M. W. Spellman, unpublished observation.

    REFERENCES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

  1. Kentzer, E. J., Buko, A., Menon, G., and Sarin, V. K. (1990) Biochem. Biophys. Res. Commun. 171, 401-406[CrossRef][Medline] [Order article via Infotrieve]
  2. Harris, R. J., Leonard, C. K., Guzzetta, A. W., and Spellman, M. W. (1991) Biochemistry 30, 2311-2314[CrossRef][Medline] [Order article via Infotrieve]
  3. Bjoern, S., Foster, D. C., Thim, L., Wiberg, F. C., Christensen, M., Komiyama, Y., Pedersen, A. H., and Kisiel, W. (1991) J. Biol. Chem. 266, 11051-11057[Abstract/Free Full Text]
  4. Harris, R. J., Ling, V. T., and Spellman, M. W. (1992) J. Biol. Chem. 267, 5102-5107[Abstract/Free Full Text]
  5. Gohlke, M., Baude, G., Nuck, R., Grunow, D., Kannicht, C., Bringmann, P., Donner, P., and Reutter, W. (1996) J. Biol. Chem. 271, 7381-7386[Abstract/Free Full Text]
  6. Nishimura, H., Takao, T., Hase, S., Shimonishi, Y., and Iwanaga, S. (1992) J. Biol. Chem. 267, 17520-17525[Abstract/Free Full Text]
  7. Harris, R. J., van Halbeek, H., Glushka, J., Basa, L. J., Ling, V. T., Smith, K. J., and Spellman, M. W. (1993) Biochemistry 32, 6539-6547[CrossRef][Medline] [Order article via Infotrieve]
  8. Harris, R. J., and Spellman, M. W. (1993) Glycobiology 3, 219-224[Abstract/Free Full Text]
  9. Stults, N. L., and Cummings, R. D. (1993) Glycobiology 3, 589-596[Abstract/Free Full Text]
  10. Moloney, D. J., Lin, A. I., and Haltiwanger, R. S. (1997) J. Biol. Chem. 272, 19046-19050[Abstract/Free Full Text]
  11. Nakakura, N., Hietter, H., van Dorsselaer, A., and Luu, B. (1992) Eur. J. Biochem. 204, 147-153[Medline] [Order article via Infotrieve]
  12. Wang, Y., Lee, G. F., Kelley, R. L., and Spellman, M. W. (1996) Glycobiology 6, 837-843[Abstract/Free Full Text]
  13. Paulson, J. C., and Colley, K. J. (1989) J. Biol. Chem. 264, 17615-17618[Free Full Text]
  14. Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989) Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Laboratory Press, Plainview, New York
  15. Dennis, M. S., and Lazarus, R. A. (1994) J. Biol. Chem. 269, 22129-22136[Abstract/Free Full Text]
  16. Laemmli, U. K. (1970) Nature 227, 680-685[CrossRef][Medline] [Order article via Infotrieve]
  17. Lowry, O. H., Rosebrough, N. J., Farr, A. L., and Randall, R. J. (1951) J. Biol. Chem. 193, 265-275[Free Full Text]
  18. Schaffner, W., and Weissman, C. (1983) Anal. Biochem. 56, 502-514
  19. Kornfeld, R., and Kornfeld, S. (1985) Annu. Rev. Biochem. 54, 631-664[CrossRef][Medline] [Order article via Infotrieve]
  20. Geetha-Habib, M., Park, H. R., and Lennarz, W. J. (1990) J. Biol. Chem. 265, 13655-13660[Abstract/Free Full Text]
  21. Manzella, S. S., Hooper, L. V., and Baenziger, J. U. (1996) J. Biol. Chem. 271, 12117-12120[Free Full Text]


Copyright © 1998 by The American Society for Biochemistry and Molecular Biology, Inc.



This article has been cited by other articles:


Home page
GlycobiologyHome page
Y. Chigira, T. Oka, T. Okajima, and Y. Jigami
Engineering of a mammalian O-glycosylation pathway in the yeast Saccharomyces cerevisiae: production of O-fucosylated epidermal growth factor domains
Glycobiology, April 1, 2008; 18(4): 303 - 314.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Shi, C. Ge, Y. Luo, X. Hou, R. S. Haltiwanger, and P. Stanley
The Threonine That Carries Fucose, but Not Fucose, Is Required for Cripto to Facilitate Nodal Signaling
J. Biol. Chem., July 13, 2007; 282(28): 20133 - 20141.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. M. Ricketts, M. Dlugosz, K. B. Luther, R. S. Haltiwanger, and E. M. Majerus
O-Fucosylation Is Required for ADAMTS13 Secretion
J. Biol. Chem., June 8, 2007; 282(23): 17014 - 17023.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
K. Kozma, J. J. Keusch, B. Hegemann, K. B. Luther, D. Klein, D. Hess, R. S. Haltiwanger, and J. Hofsteenge
Identification and Characterization of abeta1,3-Glucosyltransferase That Synthesizes the Glc-beta1,3-Fuc Disaccharide on Thrombospondin Type 1 Repeats
J. Biol. Chem., December 1, 2006; 281(48): 36742 - 36751.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
B. Ma, J. L. Simala-Grant, and D. E. Taylor
Fucosylation in prokaryotes and eukaryotes
Glycobiology, December 1, 2006; 16(12): 158R - 184R.
[Abstract] [Full Text] [PDF]


Home page
GlycobiologyHome page
C. Loriol, F. Dupuy, R. Rampal, M.A. Dlugosz, R.S. Haltiwanger, A. Maftah, and A. Germot
Molecular evolution of protein O-fucosyltransferase genes and splice variants
Glycobiology, August 1, 2006; 16(8): 736 - 747.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Luo, A. Nita-Lazar, and R. S. Haltiwanger
Two Distinct Pathways for O-Fucosylation of Epidermal Growth Factor-like or Thrombospondin Type 1 Repeats
J. Biol. Chem., April 7, 2006; 281(14): 9385 - 9392.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Luo, K. Koles, W. Vorndam, R. S. Haltiwanger, and V. M. Panin
Protein O-Fucosyltransferase 2 Adds O-Fucose to Thrombospondin Type 1 Repeats
J. Biol. Chem., April 7, 2006; 281(14): 9393 - 9399.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
R. Rampal, A. S. Y. Li, D. J. Moloney, S. A. Georgiou, K. B. Luther, A. Nita-Lazar, and R. S. Haltiwanger
Lunatic Fringe, Manic Fringe, and Radical Fringe Recognize Similar Specificity Determinants in O-Fucosylated Epidermal Growth Factor-like Repeats
J. Biol. Chem., December 23, 2005; 280(51): 42454 - 42463.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. Xu, L. Lei, and K. D. Irvine
Regions of Drosophila Notch That Contribute to Ligand Binding and the Modulatory Influence of Fringe
J. Biol. Chem., August 26, 2005; 280(34): 30158 - 30165.
[Abstract] [Full Text] [PDF]


Home page
Hum Mol GenetHome page
J. F. Arboleda-Velasquez, R. Rampal, E. Fung, D. C. Darland, M. Liu, M. C. Martinez, C. P. Donahue, M. F. Navarro-Gonzalez, P. Libby, P. A. D'Amore, et al.
CADASIL mutations impair Notch3 glycosylation by Fringe
Hum. Mol. Genet., June 15, 2005; 14(12): 1631 - 1639.
[Abstract] [Full Text] [PDF]


Home page
Protein Sci.Home page
M. A. Wouters, I. Rigoutsos, C. K. Chu, L. L. Feng, D. B. Sparrow, and S. L. Dunwoodie
Evolution of distinct EGF domains with specific functions
Protein Sci., April 1, 2005; 14(4): 1091 - 1103.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Luo and R. S. Haltiwanger
O-Fucosylation of Notch Occurs in the Endoplasmic Reticulum
J. Biol. Chem., March 25, 2005; 280(12): 11289 - 11294.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
T. Okajima, A. Xu, L. Lei, and K. D. Irvine
Chaperone Activity of Protein O-Fucosyltransferase 1 Promotes Notch Receptor Folding
Science, March 11, 2005; 307(5715): 1599 - 1603.
[Abstract] [Full Text] [PDF]


Home page
DevelopmentHome page
L. Lei, A. Xu, V. M. Panin, and K. D. Irvine
An O-fucose site in the ligand binding domain inhibits Notch activation
Development, December 29, 2003; 130(26): 6411 - 6421.
[Abstract] [Full Text] [PDF]