Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Chabry, J.
Right arrow Articles by Chesebro, B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Chabry, J.
Right arrow Articles by Chesebro, B.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

J Biol Chem, Vol. 273, Issue 21, 13203-13207, May 22, 1998


Specific Inhibition of in Vitro Formation of Protease-resistant Prion Protein by Synthetic Peptides*

Joëlle ChabryDagger , Byron Caughey, and Bruce Chesebro§

From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840

    ABSTRACT
Top
Abstract
Introduction
Procedures
Results
Discussion
References

The transmissible spongiform encephalopathies are characterized by the conversion of the protease-sensitive prion protein (PrPsen) into a protease-resistant isoform (PrPres) associated with the neuropathogenic process in vivo. Recently, PrPres has been shown to be capable of directly inducing the conversion of PrPsen to PrPres in a cell-free in vitro system. In the present experiments, various PrP peptides were studied for their ability to enhance or inhibit this cell-free conversion reaction. None of the synthetic peptides was able to confer protease-resistance to the labeled PrPsen molecules on their own. On the contrary, peptides from the central part of the hamster PrP sequence from 106 to 141 could completely inhibit the conversion induced by preformed PrPres. The presence of residues 119 and 120 from the highly hydrophobic sequence AGAAAAGA (position 113 to 120) was crucial for an efficient inhibitory effect. Fourier transform infrared spectroscopy analysis indicated that inhibitory peptides formed high beta -sheet aggregates under the conditions of the conversion reaction, but this was also true of certain peptides that were not inhibitory. Thus, the potential to form beta -sheeted aggregates may be necessary, but not sufficient, for peptides to act as inhibitors of PrPres formation. Clearly, the amino acid sequence of the peptide is also important for inhibition. The sequence specificity of the inhibition is consistent with the idea that residues in the vicinity of positions 106-141 of PrPres and/or PrPsen are critically involved in the intermolecular interactions that lead to PrPres formation.

    INTRODUCTION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Transmissible spongiform encephalopathies (TSE)1 are fatal neurodegenerative diseases including sporadic and familial Creutzfeldt-Jakob disease, kuru and Gerstmann-Sträussler-Scheinker syndrome in humans, scrapie in sheep, and bovine spongiform encephalopathy in cattle (1, 2). TSE are characterized by the formation and accumulation of an abnormal proteinase K-resistant isoform (PrPres) of normal protease-sensitive host-encoded prion protein (PrPsen). PrPres is formed from PrPsen by a post-translational process involving conformational changes, a higher beta -sheet content, and the formation of macromolecular aggregates (3-5). PrPres is closely associated with TSE-mediated brain pathology, suggesting a crucial role of PrPres in the pathogenic process. However, in the absence of PrPsen expression in the brain tissue of recipients of scrapie-infected neurografts, no pathology outside the graft itself was observed, demonstrating that PrPres and PrPsen are both required for the pathology (6). Both cross-species transmission in vivo and efficient PrPres accumulation in vitro require a high degree of sequence homology between PrPres and PrPsen molecules. For example, in scrapie-infected neuroblastoma cells, point mutations at three positions, 108, 111, and 138, in the mouse PrP sequence are sufficient to completely block the formation of PrPres (7, 8). In a cell-free in vitro system, PrPres induces the conversion of PrPsen to PrPres (9). This interaction between PrPres and PrPsen occurs with species and strain specificities that mimic TSE species barrier effects and strain differences in vivo (10-13). Collectively, these in vivo and in vitro observations strongly suggest that precise direct interactions between PrPres and PrPsen are critical in PrPres formation and TSE pathogenesis.

In previous experiments, small synthetic peptides containing certain PrP sequences spontaneously aggregated to form fibrils with a high degree of beta -sheet secondary structure (14-17). Moreover, other synthetic PrP peptides were shown to interact with PrPsen molecules, forming an aggregated complex with increased protease resistance (18, 19). In the current study, peptides from a variety of locations in the hamster PrP sequence were studied for their ability to influence the generation of PrPres under cell-free conditions. A group of peptides from the central portion of the PrP molecule having high beta -sheet content displayed a strong inhibitory effect on the cell-free conversion assay. Based on these results, we propose the existence of sites on the central part of the PrP molecule that allow a specific binding between PrPsen and PrPres as a first step in the conversion of PrPsen to PrPres.

    EXPERIMENTAL PROCEDURES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Peptides-- The following peptides were synthesized by the laboratory of molecular structure of NIAID, NIH, Rockville MD: hamster P106-128 (KTNMKHMAGAAAAGAVVGGLGGY), P109-141 (MKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHF), P113-141 (AGAAAAGAVVGGLGGYMLGSAMSRPMMHF), and P121-141 (VVGGLGGYMLGSAMSRPMMHF). Peptides were >95% pure, and analysis by high pressure liquid chromatography revealed only a single peak. Alzheimer's disease amyloid-beta protein fragment 1-40 (Abeta -(1-40)) was purchased from Sigma. Lyophilized peptides were dissolved in deionized water at a concentration of 2 mM, distributed into 20-µl aliquots, and stored at -20 °C.

Labeling and Purification of PrPsen-- The radiolabeling and the purification of the 35S-PrPsen were performed as described previously by Raymond et al. (13). Briefly, 90% confluent cells were cultured for 30 min at 37 °C in 1.5 ml of methionine/cysteine-deficient medium followed by a 90-120-min incubation with 1.4 mCi of [35S]methionine/cysteine/25-cm2 flask. Then the cells were washed twice with phosphate-buffered saline (20 mM sodium phosphate, pH 7.4, 130 mM NaCl) and lysed in 1.5 ml of lysis buffer containing 5 mM Tris-HCl, pH 7.4, 140 mM NaCl, 5 mM EDTA, 0.5% sodium deoxycholate, and 0.5% Triton X-100. The proteins were precipitated by the addition of 5 volumes of methanol, resuspended in detergent-lipid complexes, and immunoprecipitated by overnight incubation at 4 °C with anti-PrP 3F4 monoclonal antibody (20). Immune complexes were collected by binding to protein A-Sepharose beads. Radiolabeled PrPsen was eluted from Sepharose beads using 0.1 M acetic acid and stored at 4 °C until use. The 35S-labeled hamster PrPsen used in this study was the glycophosphatidylinositol-negative form (35S-HaPrPsen) described previously (9).

Purification and Analysis of PrPres-- PrPres was purified from brains of scrapie-infected Syrian golden hamsters by detergent lysis and differential centrifugation (21). Hamsters were infected 70 days before with the hamster scrapie strain 263K. The yield of PrPres was determined by Western blotting using a rabbit polyclonal PrP antiserum (R27) raised against a synthetic hamster PrP peptide (residues 89-103) (22). The purity of the preparations was estimated at 50-60% by silver-staining of SDS-PAGE gels. The hamster PrPres preparation (HaPrPres) was then diluted to 1 mg/ml in phosphate-buffered saline containing 1% sulfobetaine 3-14 and stored at -20 °C.

Cell-free Conversion Assay-- The cell-free conversion reaction was performed as described previously (9, 13). Briefly, purified PrPres was partially denatured with 2.5 M guanidine hydrochloride for 30-60 min at 37 °C. An aliquot of 200 ng of HaPrPres, typically 8 µl, was then incubated for 40 h at 37 °C with ~1 ng of immunopurified 35S-PrPsen (~12,000 cpm/reaction) in a final volume of 20 µl of conversion buffer (50 mM sodium citrate, pH 6, 5 mM cetylpyridinium chloride, 0.625% N-lauryl sarcosinate) in the presence or absence of peptides. At the end of the incubation time, each reaction was split 1:10, the major fraction was digested with 100 µg/ml proteinase K (PK) in Tris-saline buffer (50 mM Tris, pH 8, 130 mM NaCl) for 1 h at 37 °C, and the minor part (-PK) was reserved as an undigested control. The PK reaction was stopped by the addition of 10 µl of a mixture of 4 mg/ml thyroglobulin, 20 mM Pefabloc (Boehringer-Mannheim) to each fraction (+ and -PK). Samples were then precipitated in 5 volumes of methanol and centrifuged for 20 min at 14,000 × g. The pellets were resuspended in sample buffer (65 mM Tris-HCl, pH 6.8, 5% glycerol, 5% SDS, 4 M urea, 5% beta -mercaptoethanol, 0.5% bromphenol blue), boiled 5 min, and analyzed by SDS-PAGE on NOVEX pre-cast gels. The percent of the conversion was calculated by the ratio between the PK-resistant 35S-labeled bands of approximate molecular masses 28-30 kDa and the nondigested 35S-PrPsen as quantified by phosphor autoradiographic imager analysis. At the concentration used, none of the peptides affected the PK digestion of PrPres (data not shown).

Sedimentation Experiments-- Immunopurified 35S-HaPrPsen (12,000 cpm/reaction) was incubated for 24 h at 37 °C with 200 ng of 2.5 M guanidine hydrochloride-pretreated HaPrPres in the absence or presence of indicated concentrations of peptides P-(109-141), P-(113-141), P-(121-141), and Abeta -(1-40). At the end of the incubation time, the samples were centrifuged at room temperature for 20 min at 14,000 × g. The supernatants and the pellets were separately collected and methanol-precipitated before SDS-PAGE analysis and phosphor autoradiographic imager quantification.

Fourier Transform Infrared Spectroscopy-- The dried peptides were rehydrated by mixing with conversion buffer and incubated for 4-60 h at room temperature before Fourier transform infrared spectroscopy analysis. Samples (6 µl) were loaded into variable path-length cells with CaF2 plates adjusted to a path length of 6 µm. After purging the sample chamber to reduce the water vapor contribution, spectra were collected with a Perkin-Elmer system 2000 spectrometer. Spectral parameters were as follows: 254 scans; 4-cm-1 resolution; 1 cm/sec optical path difference velocity; Kaiser-Bessel apodization. Buffer spectra were subtracted from peptide spectra to give a flat base line in the 1800-2200-cm-1 region. A water vapor spectrum was then subtracted to minimize the water vapor bands in the 1750-1850-cm-1 region.

    RESULTS
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Inhibition of Conversion by Hamster PrP Peptides-- Various PrP synthetic peptides, whose localization on the primary hamster PrP sequence is shown in Fig. 1A, were tested for effects on the in vitro conversion of metabolically labeled PrPsen molecules into PrPres. The peptides were used in the cell-free conversion assay at a final concentration of 0.8 mM. As shown in Fig. 1B, the non-PK-treated 35S-HaPrPsen appeared as a double band with molecular masses of 30 and 28.5 kDa, corresponding to mono- or unglycosylated forms of the molecule, respectively. In the absence of HaPrPres, no PK-resistant bands were seen in the control experiment. In those conditions, none of the peptides was able by itself to promote the conversion of 35S-HaPrPsen to a PK-resistant form (Fig. 1B, lanes marked -). In the presence of 200 ng of HaPrPres, two PK-resistant 35S-labeled bands were obtained with molecular masses of 24 and 20 kDa (Fig. 1B, lanes marked +). However, two synthetic hamster peptides, P-(106-128) and P-(109-141), were able to inhibit the formation of 35S-labeled PK-resistant PrP bands. A third peptide, P-(89-103), partially inhibited the conversion, and six other peptides, P-(23-37), P-(57-64), P-(57-72), P-(57-80), P-(139-170), and P-(218-232) failed to inhibit the conversion.


View larger version (42K):
[in this window]
[in a new window]
 
Fig. 1.   Effect of PrP peptides on cell-free conversion. A, schematic representation of hamster PrP sequence and localization of the synthetic hamster PrP peptides. The PrP sequence is shown as a horizontal box, sites for the addition of Asn-linked oligosaccharides are shown as Vs, the disulfide bond is shown as S-S, the glycophosphatidylinositol anchor attachment signal and the signal peptide are shown as the carboxyl-terminal (term) and amino-terminal black boxes, respectively. The hatched boxes depict the four octapeptide repeat regions. The methionine residues at positions 109 and 112 allowing the protein recognition by the anti-hamster PrP monoclonal antibody 3F4 are designated as M. The location of the peptides (P) used and their designation are indicated below the PrP sequence. B, 35S-HaPrPsen (12,000 cpm/reaction, ~1 ng) was incubated for 40 h at 37 °C in conversion buffer without peptide (lane marked control) or with a final concentration of 0.8 mM each of synthetic peptide in the presence (lanes marked +) or in the absence (lanes marked -) of 200 ng of HaPrPres. At the end of the incubation time, samples were analyzed by SDS-PAGE and phosphor image autoradiography as described under "Experimental Procedure." The first lane shows the 35S-HaPrPsen without the PK digestion. Molecular mass markers in kilodaltons are indicated on the left.

The quantitative effect of peptide concentration on the cell-free conversion was examined further using the two most inhibitory hamster peptides (Fig. 2A). The peptide concentrations required to inhibit 50% of the hamster PrP conversion reaction (IC50) were calculated to be 230 and 30 µM for the peptides P-(106-128) and P-(109-141), respectively (Fig. 2B). In contrast, an unrelated amyloidogenic peptide, Alzheimer's Abeta -(1-40), was unable to inhibit the PrPsen to PrPres conversion at all concentrations tested (Figs. 2, A and B). These results clearly demonstrated that the conversion was specifically inhibited by peptides from the central portion of PrP molecule.


View larger version (39K):
[in this window]
[in a new window]
 
Fig. 2.   Dose response of the inhibition of the conversion reaction induced by hamster P-(106-128), P-(109-141), and amyloid-beta -protein fragment 1-40 (Abeta -(1-40)) peptides. A, SDS-PAGE phosphor image of representative conversion reactions obtained after PK digestion (PK+) in the absence (-) or presence of indicated concentration of peptides, P-(106-128), P-(109-141), and Abeta -(1-40). The first lane on the left panel represents the PK-untreated sample (PK-). The second lane on the same panel represents the conversion reaction performed in the absence of hamster PrPres (HaPrPres-). Molecular mass markers in kilodaltons are indicated on the left. B, dose response curves of the inhibition of the hamster conversion reactions induced by hamster P-(106-128), P-(109-141), and Abeta -(1-40) peptides. The experiments were performed as described under "Experimental Procedures." Each point represents the mean of three independent experiments ± S.D. (bars). The black symbols represent the conversion assay done with 200 ng of HaPrPres mixed with 12,000 cpm of immunopurified 35S-labeled HaPrPsen in the presence of hamster peptide sequences, and the open symbols represent the experiments done in the presence of Abeta -(1-40) peptide. The data are plotted as the percentage of the ratio between the conversion in the presence of peptide and the control conversion reaction in the absence of peptide.

Importance of the 8-Amino Acid Sequence 113-120-- The PrP synthetic peptide AGAAAAGA from position 113 to 120 has been described as the most highly amyloidogenic peptide in the protein (14). To assess the influence of the AGAAAAGA sequence contained in both P-(106-128) and P-(109-141), we synthesized two peptides differing only in this hydrophobic sequence, P-(113-141) and P-(121-141). The P-(113-141) peptide sequence efficiently inhibited the in vitro conversion with an IC50 value of 40 µM (Figs. 3, A and B). In contrast, the P-(121-141) peptide failed to inhibit the conversion at all of the concentrations used (Figs. 3, A and B). When incubated with the labeled PrPsen in the absence of PrPres, none of these peptides conferred PK resistance to PrPsen molecules (Fig. 3A). Thus, the hydrophobic sequence from 113 to 120 appeared to be essential to the inhibitory effect of peptides from this region of PrP.


View larger version (28K):
[in this window]
[in a new window]
 
Fig. 3.   Assessment of the importance of the PrP-(113-120) sequence in the inhibition of the conversion. A, SDS-PAGE phosphor image of representative conversion reactions performed in the absence or presence of increasing concentration of peptides P-(113-141) (left panel) and P-(121-141) (right panel) or with a concentration of 800 µM each of peptides in the absence of hamster PrPres (HaPrPres-). The samples were PK-treated as described under "Experimental Procedures" before SDS-PAGE analysis except the first lane on the left panel, which represents one-tenth of a conversion reaction and was nondigested with PK. B, hamster P-(113-141), P-(115-141), P-(117-141), P-(119-141), and P-(121-141) primary sequence peptides and dose response curves of the inhibition of the conversion reactions. The data represent the mean of three independent experiments and are plotted as the percentage of the ratio between the conversion in the presence of the peptide and the control conversion reaction. The sequences of the peptides used are indicated above the graph.

To find the minimal number of hydrophobic amino acid residues from the AGAAAAGA sequence required for inhibiting the conversion reaction, three partially deleted peptides were synthesized (P-(119-141), P-(117-141), and P-(115-141), Fig. 3B). The presence of two of these hydrophobic residues was sufficient to allow the inhibition of the conversion because P-(119-141) was nearly as inhibitory as P-(113-141). However, the IC50 was decreased up to 3-fold as additional hydrophobic amino acid residues were added (Fig. 3B).

Conformational Analysis of Inhibitory Versus Noninhibitory Peptides-- Fourier transform infrared spectroscopy was used to compare the conformations of the PrP and Abeta -(1-40) peptides to see if there was a correlation between inhibitory efficacy and conformation. For this purpose, peptides were incubated for 4-60 h in conversion buffer without any PrPsen or PrPres. Fourier transform infrared spectra of peptides incubated for 24 h at a concentration of 2 mM are shown in Fig. 4. Five of the peptides (P-(106-128), P-(109-141), P-(113-141), P-(121-141), and Abeta -(1-40)) showed prominent absorbance maxima at ~1630 cm-1 that were indicative of a high beta -sheet content. For P-(109-141), this predominant absorbance at 1630 cm-1 was maintained down to concentrations of 0.2 mM. These same five peptides were at least partially insoluble as each formed a visible particulate suspension. Two other PrP peptides (P-(89-103) and P-(218-232)) maintained clear solutions and had absorbance maxima near 1667 cm-1, with no evidence of the beta -sheet absorbance at ~1630 cm-1. Although all the inhibitory peptides showed evidence of a high beta -sheet content, other peptides, such as P-(121-141) and Abeta -(1-40), showed a similar beta -sheet content but gave no inhibition of conversion. Thus, the potential to form a high amount of beta -sheet structure might be necessary, but not sufficient, for the specific inhibitory activity of any given peptide.


View larger version (25K):
[in this window]
[in a new window]
 
Fig. 4.   Fourier transform infrared spectroscopy. The peptides were incubated in conversion buffer for 24 h at room temperature as described under "Experimental Procedures." Buffer spectra were subtracted from peptide spectra to give a flat base line in the 1800-2200 cm-1 region. A water spectrum was then subtracted to minimize the water vapor bands in the 1750-1850 cm-1 region.

Peptide Sedimentation Studies-- Considering the propensity of hydrophobic PrP peptides to aggregate in vitro, we investigated whether the inhibition of the conversion could be explained by peptide-induced aggregation of 35S-HaPrPsen, which might prevent conversion of this precursor protein. For this purpose, conversion reaction mixtures were centrifuged in the presence or absence of various peptides, and pellet and supernatant fractions were analyzed for 35S-HaPrPsen (Fig. 5). Whereas 35S-HaPrPsen remained soluble in the absence of peptides, incubation with either inhibitory peptides (P-(109-141), P-(113-141)) or noninhibitory peptides (P-(121-141), Abeta -(1-40)) caused aggregation and pelleting of 35S-HaPrPsen. Thus, although peptide-induced aggregation of PrPsen occurred, this sedimentation was not sufficient for the inhibition of the conversion reaction.


View larger version (40K):
[in this window]
[in a new window]
 
Fig. 5.   Sedimentation properties of the 35S-labeled PrPsen in conversion reaction mixtures with or without peptides. SDS-PAGE phosphor image of supernatant (S) and pellet (P) fractions obtained by centrifugation at 14,000 × g for 20 min of conversion reactions performed by mixing 35S-HaPrPsen with 200 ng of hamster PrPres in the absence (control) or presence of 100 µM P-(109-141), 100 µM P-(113-141), 400 µM P-(121-141), or 400 µM Abeta -(1-40). Molecular mass markers are indicated on the left.

    DISCUSSION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

In the present report, we used PrP synthetic peptides to map portions of the molecule that may be involved in PrPres-PrPsen interactions. Peptides from the central part of PrP sequence, P-(106-128), P-(109-141), and P-(113-141), were very efficient in inhibiting the in vitro cell-free conversion (30 µM < IC50 < 230 µM). The inhibition of the cell-free conversion assay induced by such peptides suggests that specific interactions between PrPsen and PrPres may involve the central region of the molecule. Recently, Hölscher et al. (23) showed that a mutant mouse PrP lacking the sequence from 114 to 121 (AGAAAAGA) is not converted into a proteinase K-resistant isoform after expression in scrapie-infected mouse neuroblastoma cells. In our current studies, the presence of the corresponding hamster sequence from 113 to 120 correlated with the inhibition of the conversion reaction. Indeed, all the peptides having this sequence such as P-(106-128), P-(109-1410, and P-(113-141) had an inhibitory effect, whereas P-(121-141) did not exhibit this property (Figs. 3, A and B). Interestingly, residues 119 and 120 appeared to be most critical to the inhibition as P-(119-141) was nearly as effective as P-(113-141) (Fig. 3B). Peptides from the amino-terminal region such as P-(23-37), P-(57-64), P-(57-72), and P-(57-80) and from the carboxyl-terminal region such as P-(139-170) and P-(218-232) did not inhibit the conversion reaction. Only P-(89-103) was able to slightly decrease the conversion when incubated at the high concentration of 0.8 mM (Fig. 1B). P-(89-103) is contained in the PK-resistant core of PrPres, and its location is adjacent to the most inhibitory peptide sequences. These data suggested that, unlike the central portion of PrPres, the amino- and the carboxyl-terminal regions of the molecule are less involved in the intermolecular interactions resulting in PrPres formation. This explanation is consistent with the fact that the carboxyl- and amino-terminal portions of PrPres are more sensitive to the PK digestion than the central part (21, 24).

In our experiments, the presence of PrP amino acid residues from 113 to 120 were required for maximal inhibition, but other amino acid residues are likely also to be involved in the specific intermolecular interaction. The adjacent sequence from residues 129 to 141 seemed to play an important modulatory role in the inhibition of conversion, since P-(106-128) was significantly less inhibitory compared with P-(109-141) (Figs. 2, A and B). This interpretation is consistent with a previous report showing that a point mutation at position 138 could block the accumulation of PrPres in the mouse neuroblastoma cell system (8). Together these results suggest that the region of residue 138 in the PrP polypeptide is important in the intermolecular interactions leading to PrPres formation.

The mechanism of action of the inhibitory peptides is still unclear. Possibly the inhibitory peptides mimic the structure of PrPres and competitively bind to PrPsen molecules to block the conversion process. Alternatively, peptides could bind to PrPres itself, blocking further interaction with PrPsen. In the conversion reaction buffer, the peptides P-(106-128), P-(109-141), and P-(113-141) possessed a high beta -sheet content reminiscent to brain-derived PrPres (3-5). Whether the active state of the inhibitory peptides is the soluble or aggregated form is not known. However, their mechanism of action cannot be explained merely by their tendency to form beta -sheet structure and sedimentable aggregates with PrPsen, since noninhibitory peptides such as P-(121-141) and Abeta -(1-40) displayed the same biochemical properties.

In our hands, none of the tested peptides were capable of conferring PK resistance to 35S-PrPsen (Fig. 1B). Using slightly different conditions, other authors have shown that incubation of hamster PrPsen with hamster peptide P-(90-145) resulted in the formation of a PK-resistant, sedimentable PrPsen·peptide complex (18, 19). Upon PK digestion, no shift of the molecular mass of this PrPsen·peptide complex was reported. Thus, this complex may be a large aggregate unaccessible to PK, in contrast to brain-derived PrPres and PrPres formed in our cell-free conversion experiments, which loses ~67 amino-terminal amino acid residues (6-7 kDa) with PK treatment.

Studies using PrP may suggest new approaches for possible therapeutic intervention. The ability of PrP peptides to inhibit the accumulation of PrPres in vivo remains to be established. Nevertheless, PrP peptides dispensed by direct injection or delivered by gene therapy might provide specific therapeutic treatment for TSE diseases. Furthermore, structural analysis of the minimal peptide sequence required for inhibition of conversion might lead to development of nonpeptide compounds with therapeutic potential.

    ACKNOWLEDGEMENTS

We wish to thank Gary Hettrick for help with the preparation of the figures, Dr. Jan Lukszo for synthesis and purification of peptides, Dr. Suzette A. Priola for stimulating discussions, and Drs. Heidi Super, Jim Fox, and Kim Hasenkrug for critical reading of the manuscript.

    FOOTNOTES

* The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

Dagger Supported by INSERM and by the Fondation pour la Recherche Médicale.

§ To whom correspondence should be addressed: Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, 903 South 4th St., Hamilton, MT 59840. Tel.: 406-363-9354; Fax: 406-363-9204; E-mail: bchesebro{at}nih.gov.

1 The abbreviations used are: TSE, transmissible spongiform encephalopathies; PrP, prion protein; PrPsen, protease-sensitive prion protein; PrPres, protease-resistant prion protein; Abeta -(1-40), amyloid-beta protein fragment 1-40; HaPrPsen, hamster PrPsen; PAGE, polyacrylamide gel electrophoresis; PK, proteinase K.

    REFERENCES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

  1. Caughey, B., and Chesebro, B. (1997) Trends Cell Biol. 7, 56-62
  2. Prusiner, S. B., Telling, G., Cohen, F. E., and DeArmond, S. J. (1996) Semin. Virol. 7, 159-173[CrossRef]
  3. Pan, K.-M., Baldwin, M., Nguyen, J., Gasset, M., Serban, A., Groth, D., Mehlhorn, I., Huang, Z., Fletterick, R. J., Cohen, F. E., and Prusiner, S. B. (1993) Proc. Natl. Acad. Sci. U. S. A. 90, 10962-10966[Abstract/Free Full Text]
  4. Safar, J., Roller, P. P., Gadjusek, D. C., and Gibbs, C. J. (1993) J. Biol. Chem. 268, 20276-20284[Abstract/Free Full Text]
  5. Caughey, B., Dong, A., Bhat, K. S., Ernst, D., Hayes, S. F., and Caughey, W. S. (1991) Biochemistry 30, 7672-7680[CrossRef][Medline] [Order article via Infotrieve]
  6. Brandner, S., Isenmann, S., Raeber, A. J., Fischer, M., Sailer, A., Kobayashi, Y., Marino, S., Weissmann, C., and Aguzzi, A. (1996) Nature 379, 339-343[CrossRef][Medline] [Order article via Infotrieve]
  7. Priola, S. A., Caughey, B., Race, R. E., and Chesebro, B. (1994) J. Virol. 68, 4873-4878[Abstract/Free Full Text]
  8. Priola, S. A., and Chesebro, B. (1995) J. Virol. 69, 7754-7758[Abstract]
  9. Kocisko, D. A., Come, J. H., Priola, S. A., Chesebro, B., Raymond, G. J., Lansbury, P. T., and Caughey, B. (1994) Nature 370, 471-474[CrossRef][Medline] [Order article via Infotrieve]
  10. Kocisko, D. A., Priola, S. A., Raymond, G. J., Chesebro, B., Lansbury, P. T., and Caughey, B. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 3923-3927[Abstract/Free Full Text]
  11. Bessen, R. A., Kocisko, D. A., Raymond, G. J., Nandan, S., Lansbury, P. T., and Caughey, B. (1995) Nature 375, 698-700[CrossRef][Medline] [Order article via Infotrieve]
  12. Bossers, A., Belt, P. B. G., Raymond, G. J., Caughey, B., de Vries, R., and Smits, M. A. (1997) Proc. Natl. Acad. Sci. U. S. A. 94, 4931-4936[Abstract/Free Full Text]
  13. Raymond, G. J., Hope, J., Kocisko, D. A., Priola, S. A., Raymond, L. D., Bossers, A., Ironside, J., Will, R. G., Chen, S. G., Petersen, R. B., Gambetti, P., Rubenstein, R., Smits, M. A., Lansbury, P. T., and Caughey, B. (1997) Nature 388, 285-288[CrossRef][Medline] [Order article via Infotrieve]
  14. Gasset, M., Baldwin, M. A., Llyod, D. H., Gabriel, J-M., Holtzman, D. M., Cohen, F. E., Fletterick, R., and Prusiner, S. B. (1992) Proc. Natl. Acad. Sci. U. S. A. 89, 10940-10944[Abstract/Free Full Text]
  15. Come, J. H., Fraser, P. E., and Lansbury, P. T. (1993) Proc. Natl. Acad. Sci. U. S. A. 90, 5959-5963[Abstract/Free Full Text]
  16. Forloni, G., Angeretti, N., Chiesa, R., Monzani, E., Salmona, M., Bugiani, O., and Tagliavini, F. (1993) Nature 362, 543-546[CrossRef][Medline] [Order article via Infotrieve]
  17. Hope, J., Shearman, M. S., Baxter, H. C., Chong, A., Kelly, S. M., and Price, N. C. (1996) Neurodegeneration 5, 1-11[CrossRef][Medline] [Order article via Infotrieve]
  18. Kaneko, K., Peretz, D., Pan, K.-M., Blochberger, T. C., Wille, H., Gabizon, R., Griffith, O. H., Cohen, F. E., Baldwin, M. A., and Prusiner, S. B. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 11160-11164[Abstract/Free Full Text]
  19. Kaneko, K., Wille, H., Mehlorn, I., Zhang, H., Ball, H., Cohen, F. E., Baldwin, M. A., and Prusiner, S. B. (1997) J. Mol. Biol. 270, 574-586[CrossRef][Medline] [Order article via Infotrieve]
  20. Kascsak, R. J., Rubenstein, R., Merz, P. A., Tonna deMasi, M., Fersko, R., Carp, R. I., Wisniewski, H. M., and Diringer, H. (1987) J. Virol. 61, 3688-3693[Abstract/Free Full Text]
  21. Hope, J., Morton, L. J. D., Farquhar, C. F., Multhaup, G., Beyreuther, K., and Kimberlin, R. H. (1986) EMBO J. 5, 2591-2597[Medline] [Order article via Infotrieve]
  22. Caughey, B., Raymond, G. J., Ernst, D., and Race, R. E. (1991) J. Virol. 65, 6597-6603[Abstract/Free Full Text]
  23. Hölscher, C., Delius, H., and Bürckle, A. (1998) J. Virol. 72, 1153-1159[Abstract/Free Full Text]
  24. Oesch, B., Westaway, D., Walchli, M., McKinley, M. P., Kent, S. B., Aebersold, R., Barry, R. A., Tempst, P., Teplow, D. B., Hood, L. E., Prusiner, S. B., and Weissmann, C. (1985) Cell 40, 735-746[CrossRef][Medline] [Order article via Infotrieve]


Copyright © 1998 by The American Society for Biochemistry and Molecular Biology, Inc.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
BrainHome page
C. R Trevitt and J. Collinge
A systematic review of prion therapeutics in experimental models
Brain, September 1, 2006; 129(9): 2241 - 2265.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. M. Norstrom and J. A. Mastrianni
The AGAAAAGA Palindrome in PrP Is Required to Generate a Productive PrPSc-PrPC Complex That Leads to Prion Propagation
J. Biol. Chem., July 22, 2005; 280(29): 27236 - 27243.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A.-L. Bergstrom, H. Cordes, N. Zsurger, P. M. H. Heegaard, H. Laursen, and J. Chabry
Amidation and Structure Relaxation Abolish the Neurotoxicity of the Prion Peptide PrP106-126 in Vivo and in Vitro
J. Biol. Chem., June 17, 2005; 280(24): 23114 - 23121.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
U. Bertsch, K. F. Winklhofer, T. Hirschberger, J. Bieschke, P. Weber, F. U. Hartl, P. Tavan, J. Tatzelt, H. A. Kretzschmar, and A. Giese
Systematic Identification of Antiprion Drugs by High-Throughput Screening Based on Scanning for Intensely Fluorescent Targets
J. Virol., June 15, 2005; 79(12): 7785 - 7791.
[Abstract] [Full Text] [PDF]


Home page
J. Gen. Virol.Home page
C.-L. Kim, A. Karino, N. Ishiguro, M. Shinagawa, M. Sato, and M. Horiuchi
Cell-surface retention of PrPC by anti-PrP antibody prevents protease-resistant PrP formation
J. Gen. Virol., November 1, 2004; 85(11): 3473 - 3482.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
G. Moroncini, N. Kanu, L. Solforosi, G. Abalos, G. C. Telling, M. Head, J. Ironside, J. P. Brockes, D. R. Burton, and R. A. Williamson
Motif-grafted antibodies containing the replicative interface of cellular PrP are specific for PrPSc
PNAS, July 13, 2004; 101(28): 10404 - 10409.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
M. L. DeMarco and V. Daggett
From conversion to aggregation: Protofibril formation of the prion protein
PNAS, February 24, 2004; 101(8): 2293 - 2298.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
B. Kundu, N. R. Maiti, E. M. Jones, K. A. Surewicz, D. L. Vanik, and W. K. Surewicz
Nucleation-dependent conformational conversion of the Y145Stop variant of human prion protein: Structural clues for prion propagation
PNAS, October 14, 2003; 100(21): 12069 - 12074.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
N. Daude, M. Marella, and J. Chabry
Specific inhibition of pathological prion protein accumulation by small interfering RNAs
J. Cell Sci., July 1, 2003; 116(13): 2775 - 2779.
[Abstract] [Full Text] [PDF]


Home page
Br Med BullHome page
B. Caughey
Prion protein conversions: insight into mechanisms, TSE transmission barriers and strains
Br. Med. Bull., June 1, 2003; 66(1): 109 - 120.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
G. S. Baron and B. Caughey
Effect of Glycosylphosphatidylinositol Anchor-dependent and -independent Prion Protein Association with Model Raft Membranes on Conversion to the Protease-resistant Isoform
J. Biol. Chem., April 18, 2003; 278(17): 14883 - 14892.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
R. S. Mishra, Y. Gu, S. Bose, S. Verghese, S. Kalepu, and N. Singh
Cell Surface Accumulation of a Truncated Transmembrane Prion Protein in Gerstmann-Straussler-Scheinker Disease P102L
J. Biol. Chem., June 28, 2002; 277(27): 24554 - 24561.
[Abstract] [Full Text] [PDF]


Home page
J. Gen. Virol.Home page
C. Wegner, A. Romer, R. Schmalzbauer, H. Lorenz, O. Windl, and H. A. Kretzschmar
Mutant prion protein acquires resistance to protease in mouse neuroblastoma cells
J. Gen. Virol., May 1, 2002; 83(5): 1237 - 1245.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
H. Moriyama, H. K. Edskes, and R. B. Wickner
[URE3] Prion Propagation in Saccharomyces cerevisiae: Requirement for Chaperone Hsp104 and Curing by Overexpressed Chaperone Ydj1p
Mol. Cell. Biol., December 1, 2000; 20(23): 8916 - 8922.
[Abstract] [Full Text]


Home page
J. Virol.Home page
R. Race, M. Oldstone, and B. Chesebro
Entry versus Blockade of Brain Infection following Oral or Intraperitoneal Scrapie Administration: Role of Prion Protein Expression in Peripheral Nerves and Spleen
J. Virol., January 1, 2000; 74(2): 828 - 833.
[Abstract] [Full Text]


Home page
Proc. Natl. Acad. Sci. USAHome page
M. P. Morrissey and E. I. Shakhnovich
Evidence for the role of PrPC helix 1 in the hydrophilic seeding of prion aggregates
PNAS, September 28, 1999; 96(20): 11293 - 11298.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
J. Chabry, S. A. Priola, K. Wehrly, J. Nishio, J. Hope, and B. Chesebro
Species-Independent Inhibition of Abnormal Prion Protein (PrP) Formation by a Peptide Containing a Conserved PrP Sequence
J. Virol., August 1, 1999; 73(8): 6245 - 6250.
[Abstract] [Full Text]


Home page
J. Biol. Chem.Home page
B. Caughey, G. J. Raymond, and R. A. Bessen
Strain-dependent Differences in beta -Sheet Conformations of Abnormal Prion Protein
J. Biol. Chem., November 27, 1998; 273(48): 32230 - 32235.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. Hughes, R. M. Burke, and A. J. Doig
Inhibition of Toxicity in the beta -Amyloid Peptide Fragment beta -(25-35) Using N-Methylated Derivatives. A GENERAL STRATEGY TO PREVENT AMYLOID FORMATION
J. Biol. Chem., August 11, 2000; 275(33): 25109 - 25115.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Horiuchi, G. S. Baron, L.-W. Xiong, and B. Caughey
Inhibition of Interactions and Interconversions of Prion Protein Isoforms by Peptide Fragments from the C-terminal Folded Domain
J. Biol. Chem., April 27, 2001; 276(18): 15489 - 15497.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
V. A. Lawson, S. A. Priola, K. Wehrly, and B. Chesebro
N-terminal Truncation of Prion Protein Affects Both Formation and Conformation of Abnormal Protease-resistant Prion Protein Generated in Vitro
J. Biol. Chem., September 14, 2001; 276(38): 35265 - 35271.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y. Gu, H. Fujioka, R. S. Mishra, R. Li, and N. Singh
Prion Peptide 106-126 Modulates the Aggregation of Cellular Prion Protein and Induces the Synthesis of Potentially Neurotoxic Transmembrane PrP
J. Biol. Chem., January 11, 2002; 277(3): 2275 - 2286.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Chabry, J.
Right arrow Articles by Chesebro, B.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Chabry, J.
Right arrow Articles by Chesebro, B.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1998 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement