Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Parker, A. E.
Right arrow Articles by Luyten, W. H. M. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Parker, A. E.
Right arrow Articles by Luyten, W. H. M. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

J Biol Chem, Vol. 273, Issue 29, 18332-18339, July 17, 1998


A Human Homologue of the Schizosaccharomyces pombe rad1+ Checkpoint Gene Encodes an Exonuclease*

Andrew E. ParkerDagger §, Inez Van de WeyerDagger , Marc C. LausDagger , Inge Oostveen, Jeff Yon, Peter Verhasselt, and Walter H. M. L. LuytenDagger parallel

From the Dagger  Department of Experimental Molecular Biology and the  Department of Applied Molecular Biology, Janssen Research Foundation, Turnhoutseweg 30, B-2340 Beerse, Belgium

    ABSTRACT
Top
Abstract
Introduction
Procedures
Results
Discussion
References

In the fission yeast Schizosaccharomyces pombe the rad1+ gene is required for both the DNA damage-dependent and the DNA replication-dependent cell cycle checkpoints. We have identified a human homologue of the S. pombe rad1+ gene, designated Hrad1, as well as a mouse homologue: Mrad1. Two Hrad1 alternative splice variants with different open reading frames have been identified; one codes for a long form, Hrad1A, and the other encodes a short form because of N-terminal truncation, Hrad1B. Hrad1A has 60% identity to the S. pombe rad1+ sequence at the DNA level and 49% identity and 72% similarity at the amino acid level. Northern blot analysis indicates elevated levels of expression in testis and cancer cell lines. Chromosomal localization by fluorescence in situ hybridization indicates that Hrad1 is located on chromosome 5p13.2-13.3. This region is subject to loss of heterozygosity in several human cancers. Hrad1 also shares homology with the Saccharomyces cerevisiae RAD17 and Ustilago maydis REC1 proteins. REC1 has previously been characterized as a 3' right-arrow 5' exonuclease with a C-terminal domain essential for cell cycle checkpoint function. We have expressed and purified polyhistidine-tagged fusions of Hrad1A and Hrad1B and show that HisHrad1A has 3' right-arrow 5' exonuclease activity, whereas HisHrad1B lacks such activity. The biological functions of the two proteins remain to be determined.

    INTRODUCTION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

For any dividing cell it is essential to maintain the integrity of the genome ensuring that DNA replication occurs once per cell cycle and that identical chromosomal copies are distributed equally to two daughter cells at mitosis. When cells are subjected to conditions that interfere with DNA replication or spindle assembly or that cause damage to DNA, cell-cycle progression halts, permitting cell cycle phase completion or DNA repair. These control mechanisms are referred to as "checkpoints" (reviewed in Refs. 1-3). The loss of checkpoint control in mammalian cells, most notably through the inactivation of p53, results in genomic instability leading to the amplification, rearrangement, or loss of chromosomes, events that commonly occur in cancer cells (2, 4).

Much of our current knowledge about checkpoint control has been obtained from studies using budding (Saccharomyces cerevisiae) and fission (Schizosaccharomyces pombe) yeast (reviewed in Ref. 5). In the fission yeast at least two distinct checkpoint pathways have been identified: the DNA replication-dependent checkpoint pathway that ensures that S phase is completed before M phase is initiated and the DNA damage-dependent checkpoint pathway that acts to halt the cell cycle when genomic integrity is compromised (5). The products of six genes, rad1+, rad3+, rad9+, rad17+, rad26+, and hus1+, have been identified in S. pombe as essential components of both checkpoint pathways (5). In S. cerevisiae the two checkpoint pathways are genetically separable; four gene products, RAD9, RAD17, RAD24, and MEC3, have been identified as essential for the DNA damage-dependent checkpoint pathway, and three gene products, POL2, RFC5, and DPB11, are essential for the DNA replication-dependent checkpoint pathway (reviewed in Refs. 3-5). Several of the S. pombe checkpoint genes have structural homologues in the budding yeast and further conservation across eukaryotes has recently been demonstrated with the cloning of two human homologues of S. pombe rad3+, ATM (ataxia telangiectasia mutated) (6) and ATR (ataxia telangiectasia and rad3+ related) (7, 8), and a human homologue of S. pombe rad9+, Hrad9 (9).

The identification and characterization of human homologues of yeast checkpoint genes provides clear evidence that at least some checkpoint pathways are conserved between mammals and yeast. Currently little is known about the biochemistry of checkpoint control. The genetic data in yeast suggest that a complex of proteins mediates the monitoring of replication-specific structures and damaged DNA (10). Furthermore, recent biochemical studies in S. pombe and humans suggest that the cell cycle arrest in response to DNA damage is brought about by the activation of a signal transduction pathway involving the putative protein kinases ATM/ATR and Hchk1, resulting in inhibitory phosphorylation of Cdc25 and subsequent stabilization of the inhibitory Tyr15 phosphorylation of Cdc2 (7, 11-14).

Although a great deal of progress has been made in identifying the kinase components of the signal transduction pathway mediating cell cycle arrest (6-8, 12), there has been little progress in identifying the sensing mechanisms that activate the checkpoint pathways. The S. pombe rad1+ gene acts early in the checkpoint pathway (15) and presumably plays a role in the transmission of information regarding the state of the genome to the checkpoint control mechanism. The rad1-1 mutant is extremely sensitive to all DNA damaging agents (15, 16) and fails to invoke a G2 arrest in response to ionizing radiation yet is DNA repair-competent, indicating a loss in the ability to recognize the presence of damaged DNA (15). The rad1-1 mutant is also sensitive to hydroxyurea, indicating an uncoupling between the completion of S phase and entry into mitosis (15), and is synthetically lethal when combined with mitosis-promoting mutations such as wee1-50 (15). The S. pombe rad1+ gene has been cloned (17), and the predicted amino acid sequence shows significant sequence similarity to the Ustilago maydis protein Rec1 (18) and S. cerevisiae RAD17 (20). Mutations in these genes lead to cell cycle checkpoint defects and other phenotypes associated with alterations in DNA repair and recombination (19, 20).

Purified Rec1 protein has been shown to have a 3' right-arrow 5' exonuclease activity (21), suggesting that Rec1/Rad1/RAD17 may be involved in modifying DNA damage (22, 23). Studies of Rec1 truncation mutants have demonstrated that the nuclease activity is located in the N-terminal half of the protein. However the Rec1-dependent checkpoint function requires the C-terminal region of the protein and does not require the exonuclease activity (24, 25). In addition, Rec1 mutants that lack exonuclease activity have a 100-fold higher rate of spontaneous mutation, indicating that the exonuclease function may be required for mismatch repair (24). Thus it would appear that the Rec1 protein is bifunctional, having an N-terminal exonuclease domain and a C-terminal checkpoint domain.

In this report we describe the cloning and characterization of a novel human cDNA, designated Hrad1, which is highly similar to the S. pombe rad1+ checkpoint gene. We also report the cloning of a mouse homologue designated Mrad1. We show that Hrad1 is subject to alternative splicing giving rise to two potential open reading frames (ORFs)1 coding for a full-length and a truncated form of Hrad1, designated Hrad1A and Hrad1B, respectively. We have expressed in Escherichia. coli and affinity purified N-terminal polyhistidine-tagged fusions of Hrad1A and Hrad1B and show that Hrad1A but not Hrad1B has 3' right-arrow 5' exonuclease activity. Hrad1B corresponds to the C-terminal domain of Rec1 that has been implicated solely in checkpoint function. Thus we can speculate that Hrad1A plays a role in the recognition and processing of DNA ends and also in checkpoint function, whereas the role of Hrad1B may be restricted to checkpoint control.

    EXPERIMENTAL PROCEDURES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Cloning and Sequencing of Human and Mouse rad1-- A search for sequences similar to S. pombe rad1+ was carried out using the TBLASTN program (26) against the GenBankTM data base. Deduced amino acid sequences were aligned using the CLUSTALW program, and similarity was determined with a blosum62 amino acid substitution matrix. An expressed sequence tag (EST) clone with significant sequence similarity to S. pombe rad1+ was identified and obtained from the Integrated Molecular Analysis of Genomes and their Expression (I.M.A.G.E.) Consortium.

DNA sequencing was carried out on double-stranded plasmid DNA with dye terminator chemistry as prescribed by the manufacturer (Perkin-Elmer/Applied Biosystems), and the products were resolved on an ABI PrismTM 377 Automated Sequencer. The complete insert sequence of the EST clone was determined.

To extend this sequence and to examine the possibility of alternative splicing, 5' and 3' RACE-PCR was carried out according to the manufacturer's instructions (CLONTECH).

For the 5' RACE, two gene-specific primers were designed to the 5' end of the putative Hrad1 ORF: GSP1 (5'-ATTTGTAGGACTTCACTCGTCATAT-3') and GSP2 (5'-TGTGTATTGATTTTGCAGACT GTCA-3'). These were used in a nested PCR reaction with Marathon-Ready human placental cDNA (CLONTECH) as the template. The first PCR reaction made use of the GSP1 PCR primer for the 3' end, combined with the AP1 primer from CLONTECH that is complementary to an adaptor ligated to the 5' end of all Marathon-Ready cDNAs. The second PCR reaction started from 1-5 µl of the first and used the GSP2 in combination with a nested AP2 primer (CLONTECH). The reaction conditions for the first RACE-PCR were 30 cycles of 30 s at 95 °C, 30 s at 65 °C and 1 min at 72 °C. The subsequent nested PCR used two-step cycles, each consisting of a 30 s denaturation step at 95 °C and a combined annealing and elongation step for 2 min, which was carried out at 72 °C for the first five cycles, at 70 °C for the five subsequent cycles and at 68 °C for the remaining 25 cycles.

For the 3'RACE, two gene-specific primers were designed to the 3' end of the putative Hrad1 ORF: GSP3 (5'-CAAGGTTATGGTTACCCTTTGATG-3') and GSP4 (5'-TCAATACACAGGAACCTGAGGAG-3'). These were used in a nested PCR reaction with Marathon-Ready human fetal cDNA (CLONTECH) as the template. The first PCR reaction made use of the GSP3 PCR primer for the 5' end, combined with the AP1 primer from CLONTECH that is complementary to an adaptor ligated to the 3' end of all Marathon-Ready cDNAs. The second PCR reaction started from 1-5 µl of the first and used the GSP4 primer in combination with a nested AP2 primer (CLONTECH). After a 1-min denaturation at 94 °C, the reaction conditions for the first RACE-PCR were 30 cycles of 30 s at 95 °C and 4 min at 68 °C, concluding with a 7-min extension at 72 °C. The subsequent nested PCR also used two-step cycles, each consisting of a 30 s denaturation step at 94 °C and a combined annealing and elongation step for 4 min, which was carried out at 72 °C for the first five cycles, at 70 °C for the five subsequent cycles and at 68 °C for the remaining 25 cycles. A final 7-min extension step at 72 °C concluded the PCR.

The PCR reaction products were resolved by agarose gel electrophoresis, and specific reaction products were excised, purified using the QIAQuick gel extraction kit (Qiagen), and ligated into the pCR2.1-TOPO vector (Invitrogen). The insert sequence of 10 independent clones was determined and compared with the putative Hrad1 cDNA sequence. The sequences obtained separated into two classes generating two ORFs that we designated Hrad1A and Hrad1B.

PCR primers were designed to amplify Hrad1A, OML003 (5'-AAGGATCCGAATGCCCCTTCTGACCCAACAGA-3') and OML001 (5'-TAGCTCGAGTCAAGACTCAGATTCAGGAACTTC-3'), and Hrad1B, OAP034 (5'-CCGCTCGAGATGTGTTACCAAGGTTAT-3') and OAP033 (5'-GCCGAATTCTCAAGACTCAGATTCAGGAA-3'), to enable subcloning into various expression vectors. The complete ORFs of Hrad1A and Hrad1B were PCR-amplified starting from cDNA prepared from human SK-N-MC neuroblastoma cells and the Marathon-Ready human placenta cDNA (CLONTECH), respectively. The amplification products were directly cloned into the pCR2.1-TOPO vector (Invitrogen), and the insert sequence from three independent clones of Hrad1A and Hrad1B was determined.

To determine the DNA sequence of mouse rad1 (Mrad1), mouse EST clones were identified by screening the GenBankTM with Hrad1, and three independent EST clones were obtained from the I.M.A.G.E. consortium. The insert sequence for each clone was determined and aligned as described for Hrad1.

Northern Blot Analysis-- Two multiple human tissue Northern blots (CLONTECH) and a human cancer cell line Northern blot (CLONTECH) were hybridized with a full-length Hrad1B cDNA probe, labeled with [alpha -32P]dCTP by random hexamer priming with the Prime-a-Gene Kit (Promega). The blots were hybridized in ExpressHyb solution according to the manufacturer's instructions (CLONTECH) and washed at high stringency (0.1 × SSC, 0.1% SDS, 50 °C, 2 × 20 min) and exposed to Kodak X-Omat autoradiography film with intensifying screens at -70 °C. The blots were then rehybridized with a human beta -actin probe (CLONTECH) labeled with [alpha -32P]dCTP as described above to verify the intactness of the RNA samples and confirm the presence of comparable amounts of RNA across lanes.

After stripping (0.1 × SSC, 0.1% SDS, 90 °C, 2 × 20 min), one of the blots was rehybridized with an oligonucleotide specific to the alternatively spliced region of Hrad1A, OAP103 (5'-CTGGAATATTTCAGGAGTTTAAA-3'), to discriminate between the transcripts. The oligonucleotide was end-labeled in a standard reaction using T4 polynucleotide kinase and [gamma -32P]ATP and hybridized to the blot at 37 °C, and the blot was washed as described for the previous hybridizations.

In addition, a multiple mouse tissue Northern blot (CLONTECH) and a mouse developmental blot (CLONTECH) were hybridized with a mouse rad1 cDNA probe (AvaI/PstI fragment) labeled by random hexamer priming as described above. The blots were washed and exposed to film and then rehybridized with the control beta -actin probe; all of these steps were carried out as described for the previous hybridizations.

S. pombe Strains, Culture, and Plasmids-- S. pombe was cultured by standard techniques (27). The genotypes of the strains used are as follows: APY002, h+ leu1-32 ura4-D18 ade6-M216, and GBY190, h+ rad1::ura4+, leu1-32, ura4-D18, ade6-M216. The complete ORF coding for Hrad1 was cloned into the SmaI site of the S. pombe expression vector pREP3X (28) using standard techniques. Transformation of S. pombe was carried out by electroporation (29).

Bacterial Expression and Purification of HisHrad1A and HisHrad1B-- The following primers were used to amplify the complete coding regions of Hrad1A and Hrad1B: OAP105 (5'-GCACAGATCTCCCCTTCTGACCCAACAGATC-3') and OAP110 (5'-GCACAGATCTTGTTACCAAGGTTATGGTTAC-3') for the 5' end of Hrad1A and Hrad1B, respectively, each in combination with the 3' PCR primer OAP033 (5'-GCCGAATTCTCAAGACTCAGATTCAGGAA-3'). The PCR product was digested with BglII and EcoRI and cloned into the corresponding sites of pRSETB (Invitrogen). This creates a fusion protein with the following amino acid sequence N-terminal to the second codon of Hrad1A or Hrad1B: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSS. The insert sequence of both constructs was verified.

The plasmids were transformed into E. coli BL21(DE3) cells, and a single colony of each was inoculated into 10 ml of LB medium (containing 10 g/liter Bacto-Tryptone (Difco), 5 g/liter Bacto Yeast extract (Difco), and 10 g/liter NaCl (Merck), brought to pH 7 with 10 N NaOH and supplemented with 100 µg/ml ampicillin) and incubated at 250 rpm at 30 °C overnight. 4 ml of the overnight culture was added to 400 ml of medium in a 2-liter Erlenmeyer flask and incubated until an A600 of 0.5 was reached. High level expression was induced by the addition of isopropyl-beta -D-thiogalactopyranoside to a final concentration of 0.5 mM and a further incubation for 20 h before the cells were harvested by centrifugation. Lysates from the harvested cells were separated into the soluble and insoluble fractions using standard procedures (30).

In the case of Hrad1A, approximately 20% of the expressed protein as judged by Coomassie staining of SDS-polyacrylamide gels was found to be present in the soluble fraction. Affinity purification was carried out using Ni-NTA-agarose essentially as described by the manufacturer (QIAGEN). The soluble material was incubated with the Ni-NTA-agarose in batch for 1 h at 4 °C on a revolving wheel. The column was then poured and washed with 5 column volumes of sonication buffer (50 mM Tris, pH 8.0, 50 mM NaCl, 1 mM EDTA, 0.5 mM PMSF) followed by Buffer RB, pH 8.0 (10 mM Tris, 10% glycerol, 1 mM 2-mercaptoethanol, 0.5 mM PMSF), Buffer RB, pH 6.3 and Buffer RB, pH 5.5. The bound protein was eluted in Buffer RB, pH 8.0, containing 250 mM imidazole. Nine 1-ml fractions were collected and analyzed by SDS-polyacrylamide gel electrophoresis. Those fractions containing HisHrad1A were pooled and dialyzed overnight (Spectra/Por 6,000 molecular weight cut-off membrane) at 4 °C against 1 liter of Buffer RB. The dialyzed material was centrifuged for 1 h at 4 °C and 100,000 × g. No pellet was visible by naked eye inspection. For Hrad1B, the expressed protein was found to be almost exclusively present in the insoluble fraction. Inclusion bodies were prepared (30) and dissolved in Buffer A (6 M guanidine HCl, 0.1 M NaH2PO4, 0.01 M Tris, pH 8.0, 1 mM 2-mercaptoethanol, 0.5 mM PMSF) at 5 ml/g wet weight. The soluble material was incubated with Ni-NTA-agarose for 1 h. The column was poured and washed with 5 column volumes of Buffer A, followed by Buffer B (8 M urea, 0.1 M NaH2PO4, 0.01 M Tris, pH 8.0, 1 mM 2-mercaptoethanol, 0.5 mM PMSF) and Buffer C (8 M urea, 0.1 M NaH2PO4, 0.01 M Tris, pH 6.3, 1 mM 2-mercaptoethanol, 0.5 mM PMSF). The bound protein was then eluted in 10 ml of Buffer B containing 250 mM imidazole. The protein was refolded by rapid 10-fold dilution in Buffer RB and dialyzed against 1 liter of Buffer RB, pH 8.0, with several changes. The dialyzed material was centrifuged for 1 h at 4 °C and 100,000 × g. No pellet was observed. The final protein concentration was determined by Bradford assay (Bio-Rad), and an aliquot was separated on a 12% SDS-polyacrylamide gel to examine the purity and integrity.

Exonuclease Assays-- The DNA used as exonuclease substrate was plasmid pBSII (KS+) (Stratagene), digested to completion with Sau3A. The DNA was either labeled at the 3' termini by incorporation of [alpha -32P]dCTP (~3000 Ci/mmol) using the Klenow fragment of E. coli DNA polymerase or at the 5' termini with [gamma -32P]ATP (~3000 Ci/mmol) using T4 polynucleotide kinase, prior to filling in 3' recessed termini with unlabeled dNTPs.

The exonuclease assay was carried out in a 20-µl volume containing 50 mM Tris acetate, pH 9, 10 mM magnesium acetate, 1 mM dithiothreitol, 0.1 mM EDTA and substrate DNA. Exonuclease assays were carried out with 2 nmol (as total DNA nucleotide) of end-labeled DNA containing 1.6 pmol of 32P-nucleotide as the terminal label at a specific activity of 2 × 103 cpm/pmol. Reactions were started by the addition of enzyme, incubated at 37 °C for 30 min unless otherwise stated and terminated by the addition of 30 µl of an ice-cold solution of salmon sperm DNA (0.5 mg/ml) in 25 mM EDTA and 50 µl of 10% trichloroacetic acid. The mixture was held on ice for 10 min and centrifuged at 4 °C and 10,000 × g for 10 min. A 75-µl aliquot of the supernatant was removed and mixed with 400 µl of scintillant (UltimaGoldTM, Packard) for determination of radioactivity by liquid scintillation counting (Tri-Carb 2100TR, Packard).

Fluorescence in Situ Hybridization Studies (FISH)-- Chromosomal localization was carried out by SeeDNA Inc. (Toronto, Ontario, Canada). Lymphocytes isolated from human blood were cultured in alpha -minimal essential medium supplemented with 10% fetal calf serum and phytohaemagglutinin at 37 °C for 68-72 h. The lymphocyte cultures were treated with bromodeoxyuridine (0.18 mg/ml) to synchronize the cell population. The synchronized cells were washed three times with serum-free medium to release the block and recultured at 37 °C for 6 h in alpha -minimal essential medium with thymidine (2.5 µg/ml). Cells were harvested, and slides were prepared by using standard procedures including hypotonic treatment, fixation, and air drying.

The Hrad1B complete ORF was gel purified and biotinylated with dATP using the Life Technologies, Inc. BioNick labeling kit (15 °C, 1 h) (31). The procedure for FISH detection was performed as described previously (31, 32). Briefly, slides were baked at 55 °C for 1 h. After RNase treatment, the slides were denatured in 70% formamide in 2 × SSC for 2 min at 70 °C followed by dehydration with ethanol. Probes were denatured at 75 °C for 5 min in a hybridization mix consisting of 50% formamide and 10% dextran sulfate. Probes were loaded on the denatured chromosomal slides. After overnight hybridization, slides were washed, and the signal was detected. FISH signals and the 4',6-diamidino-2-phenylindole (DAPI)-banding pattern were recorded separately by taking photographs, and the assignment of the FISH mapping data with chromosomal bands was achieved by superimposing FISH signals with DAPI-banded chromosomes (33).

    RESULTS
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Identification of Human and Mouse Homologues of S. pombe rad1+-- A human EST cDNA clone (accession number AA029300) was identified in the EMBL DNA data base using the TBLASTN homology searching program (26) with the S. pombe rad1+-derived amino acid sequence as the query. This clone was obtained from the I.M.A.G.E. Consortium (EST 470124), and DNA sequence analysis of the 1.2-kb insert (Figs. 1 and 2A) revealed an ORF that was highly similar to S. pombe Rad1. The predicted amino acid sequence of this ORF, however, was significantly shorter than the S. pombe Rad1 protein. To ensure that we had identified the complete sequence of the putative Hrad1 cDNA, we carried out 3' and 5' RACE-PCR. The 3' RACE clones that we obtained were all identical to the original EST cDNA sequence. The 5' RACE clones that we obtained separated into two classes. The first was identical to our original cDNA clone, and the second contained a 119-nucleotide insertion presumably originating from an alternatively spliced mRNA. This additional sequence changed the reading frame immediately upstream of the initiation codon in our original cDNA sequence and resulted in a second and longer ORF (Figs. 1 and 2A). We have named the long and short ORFs Hrad1A and Hrad1B, respectively, and their sequences have been deposited into GenBankTM under accession codes AJ004974 and AJ004975, respectively). Hrad1A has 60% identity to the S. pombe rad1+ sequence at the DNA level and 49% identity and 72% similarity at the amino acid level (Fig. 2B). The Hrad1A cDNA encodes a protein with a predicted molecular mass of approximately 31.5 kDa, and the Hrad1B protein has a predicted molecular mass of approximately 19.5 kDa.


View larger version (52K):
[in this window]
[in a new window]
 
Fig. 1.   Nucleotide sequence and predicted amino acid sequence of human rad1. The sequence presumed to be alternatively spliced is underlined, and the two presumptive initiation codons are shown in bold type. The sequences of Hrad1A and Hrad1B have been deposited into GenBankTM under accession codes AJ004974 and AJ004975, respectively.


View larger version (59K):
[in this window]
[in a new window]
 
Fig. 2.   Presumptive alternative splice and domain structure of Hrad1. A, schematic diagram of the proposed alternatively spliced forms of human rad1. B, amino acid sequence alignment between human Rad1, S. pombe Rad1, S. cerevisiae RAD17, and U. maydis REC1 performed using the CLUSTALW alignment program. Residues conserved between at least three species are highlighted in gray, those conserved in all four are highlighted in black.

A subsequent search of the data bases resulted in the identification of several mouse ESTs homologous to the Hrad1 cDNA. Three clones were obtained from the I.M.A.G.E. Consortium (accession codes AA387891, AA387463, and AA386981) and sequenced, resulting in the identification of a single ORF that encodes a protein with a predicted molecular mass of approximately 31.5 kDa (data not shown) (the nucleotide sequence was deposited into GenBankTM under accession code AJ004976). Mouse and human Rad1A are 91% identical at the amino acid level. None of the mouse clones sequenced corresponded to Hrad1B.

Northern Blot Analysis of Human and Mouse rad1-- The transcript profiles of human and mouse rad1 were examined by probing several multiple tissue Northern blots (CLONTECH), a cancer cell line Northern blot (CLONTECH), and a mouse developmental Northern blot (CLONTECH). Three transcripts of approximately 5, 3, and 1.3 kb were identified for Hrad1, and all were elevated in the cancer cell lines (Fig. 3A). All three transcripts were present in differentiated tissues with the highest levels in testis, skeletal muscle, placenta, and heart. There was a specific increase in the shortest transcript in testis. The alternative splice we identified represents a difference of 119 nucleotides, which is too small to account by itself for the differences between the three transcripts.


View larger version (63K):
[in this window]
[in a new window]
 
Fig. 3.   Northern blot analysis of Hrad1 and Mrad1. A, the multiple tissue Northern blot and cancer cell line Northern filters (CLONTECH) were hybridized with the Hrad1B-derived complete ORF. RNA size markers are indicated. The blots were then rehybridized with a human beta -actin cDNA probe (CLONTECH) to verify the loading of comparable amounts of RNA across lanes as well as the lack of degradation of the samples. B, the center blot was then hybridized with an oligonucleotide specific for the alternatively spliced region of Hrad1 to discriminate between the Hrad1A and Hrad1B transcripts. C, a mouse multiple tissue Northern blot and a developmental Northern blot (CLONTECH) were hybridized with a mouse rad1 cDNA probe. The blots were then rehybridized with a human beta -actin cDNA probe (CLONTECH). Exposure times were overnight for the Hrad1 probe and 30 min for the beta -actin probe.

To discriminate between the transcripts we probed the blot containing the testis sample with an oligonucleotide (OAP103) derived from the alternatively spliced region. This hybridized specifically to the 3-kb transcript indicating that the 1.3-kb transcript, which is highly elevated in testis does not contain the alternatively spliced region and therefore does not correspond to Hrad1A (Fig. 3B). Further searches of the EST data bases have revealed a possible alternative 3'-untranslated region (accession number AA464502), which may explain at least one of the other transcripts (data not shown).

A single transcript of approximately 2.2 kb was identified for mouse rad1 and was expressed at comparable levels in all tissues and at all stages of development tested (Fig. 3C). We have not established whether mouse rad1 is subject to alternative splicing as demonstrated for Hrad1. Our Northern blot experiment does not provide the resolution to display two transcripts differing by a 119-nucleotide alternative splice.

Complementation of S. pombe rad1-- Complementation has often been used to demonstrate biological activity for mammalian homologues of yeast proteins (34, 35). We examined whether Hrad1 could complement the UV irradiation (DNA damage-dependent checkpoint) or hydroxyurea (DNA replication-dependent checkpoint) sensitivity phenotypes of a S. pombe rad1::ura4+ strain. Hrad1A and Hrad1B were cloned into the S. pombe expression vector pREP3x (28) and transformed into wild-type and rad1::ura4+ cells. Transformants were exposed to varying doses of UV or transiently exposed to 10 mM hydroxyurea as described previously (16). We observed no complementation of the UV or hydroxyurea sensitivity phenotypes (data not shown).

Hrad1 Transcription Is Not DNA Damage-inducible-- Many genes involved in the response to DNA damage are induced by exposure to DNA damaging agents. To examine whether this was the case for Hrad1 we exposed human HaCaT cells to 30 J/m2 of UV radiation, a dose sufficient to cause DNA damage and invoke a cell cycle arrest (36). We prepared RNA at various time points up to 8 h after exposure and then determined the effect upon Hrad1 transcript level using an RNase protection assay. The level of the Hrad1 transcript remained constant throughout the time course (data not shown). Consequently, we conclude that Hrad1 transcription is not increased in response to UV-induced DNA damage.

Affinity Purified HisHrad1A Exhibits Exonuclease Activity-- The sequence of Hrad1 is highly similar to that of REC1 from U. maydis, and purified hexahistidine-tagged Rec1 has been shown to have exonuclease activity (21). To test whether Hrad1 shared this biochemical activity, both Hrad1A and Hrad1B were expressed in E. coli as N-terminal hexahistidine-tagged fusion proteins using the pRSETB inducible expression vector (Invitrogen). The proteins designated HisHrad1A and HisHrad1B were purified by immobilized metal affinity chromatography (Qiagen). Bacterially expressed HisHrad1A was found predominantly in the insoluble fraction; however, approximately 20% of the protein as judged by Coomassie staining of SDS-polyacrylamide gels was present in the soluble fraction, allowing purification under nondenaturing conditions. HisHrad1B was found exclusively in the insoluble fraction and was isolated from inclusion bodies under denaturing conditions and refolded by rapid dilution. HisHrad1A and HisHrad1B have predicted molecular masses of approximately 35.5 and 23.5 kDa, respectively. The electrophoretic mobility of the purified proteins on SDS-polyacrylamide gels was in agreement with these predictions (Fig. 4).


View larger version (43K):
[in this window]
[in a new window]
 
Fig. 4.   Purification of HisHrad1A and HisHrad1B. Aliquots of the various steps in the purification of HisHrad1A were analyzed by SDS-polyacrylamide gel electrophoresis and Coomassie Blue staining. Size markers are indicated in kDa on the left side. Lane 1, lysate of uninduced cells (equivalent to 20 µl of culture) containing HisHrad1A expression plasmid. Lane 2, lysate of induced cells (equivalent to 20 µl of culture) containing HisHrad1A expression plasmid. Lane 3, soluble fraction from induced cells (equivalent to 300 µl of culture) containing HisHrad1A expression plasmid. Lane 4, insoluble fraction from induced cells (equivalent to 300 µl of culture) containing HisHrad1A expression plasmid. Lane 5, affinity purified HisHrad1A (2 µg). Lane 6, affinity purified HisHrad1B (2 µg).

First we assayed purified HisHrad1A and HisHrad1B for the ability to release labeled 5' or 3' terminal nucleotides from linear double-stranded DNA. HisHrad1A exhibited clear nucleolytic activity (Fig. 5, A and B), releasing radionucleotide from both the 5' and the 3' termini with a 6-fold preference for the 3' end. HisHrad1B did not show any nucleolytic activity. This may be a consequence of the different purification regimes or may reflect a true difference in biological activity.


View larger version (17K):
[in this window]
[in a new window]
 
Fig. 5.   Exonucleolytic activity of affinity purified HisHrad1A. The affinity purified HisHrad1A and HisHrad1B were examined for exonuclease activity. The results are the means of four experiments. A, 3 µg of protein was incubated under standard reaction conditions with 3' 32P end-labeled double-stranded DNA for the times indicated. HisHrad1B exhibited no 3' right-arrow 5' exonuclease activity. B, 3 µg of protein was incubated under standard reaction conditions for 30 min with 3' and 5' 32P end-labeled double- and single-stranded DNA.

The conditions for optimal activity were examined and found to be similar to those observed for REC1 (21). Maximum activity was obtained in a low ionic strength buffer at pH 7.4-9.0 and containing Mg2+ (Table I). Activity was unaffected by ATP or dATP but was significantly reduced by 100 mM NaCl. The replacement of Mg2+ with Zn2+ or the addition of 10 mM EDTA resulted in complete loss of activity (Table I).

                              
View this table:
[in this window]
[in a new window]
 
Table I
Characterization of HisHrad1A nuclease activity
Reactions were carried out under standard conditions using 3'-32P-labeled double-stranded DNA as substrate with the indicated additions or modifications. 3 µg of protein was used in each reaction mix, and maximum activity was 12.5% of end nucleotide released.

The substrate specificities were also examined in greater detail. HisHrad1A has an approximately 6-fold preference for 3' termini under these assay conditions and is approximately 2-fold more active when single-stranded DNA is provided as substrate (Fig. 5B). The activity associated with HisHrad1A differs from known Mg2+-dependent exonucleases (Table II), strongly suggesting that the activity we observed is inherent in the Rad1A gene product.

                              
View this table:
[in this window]
[in a new window]
 
Table II
Comparison of nuclease activities with respect to substrate
The data for REC1, exonuclease I, lambda  exonuclease, and exonuclease III are taken from Thelen et al. (21). All Hrad1A reactions were carried out as described under "Experimental Procedures" for 30 min at 37 °C. Reaction conditions for the other (cited) enzymes were similar but not identical, so that exact numerical comparisons are not warranted.

Chromosomal Localization of Hrad1-- The chromosomal position of Hrad1as determined to establish whether a loss of heterozygosity associated with Hrad1 might be linked with any known disease. The 1.2-kb cDNA corresponding to Hrad1B (EST 470124) was used as a probe for FISH analysis. Under the conditions used, the hybridization efficiency was approximately 69% for the probe (among 100 checked mitotic figures, 69 showed signals on one pair of chromosomes). The DAPI banding pattern was used to establish that Hrad1 localizes to the short arm of chromosome 5. No additional locus was picked up by FISH detection under the conditions used. The detailed position was further determined based upon the analysis of 10 photographs leading to the conclusion that Hrad1 is located on human chromosome 5p13.3-13.2 (Fig. 6). Loss of heterozygosity of this region of chromosome 5 has been linked to a variety of human neoplasias including lung cancer (37, 38).


View larger version (30K):
[in this window]
[in a new window]
 
Fig. 6.   Chromosomal localization of the Hrad1 gene determined by FISH analysis. A, photograph of metaphase chromosome spread labeled with fluorescent Hrad1 cDNA probe. B, photograph of the same mitotic figure stained with DAPI to identify chromosomes and reveal chromosome band patterns. Comparison with panel A shows the FISH signal is located on chromosome 5. C, idiogram of chromosome 5. The signal was further localized to position p13.2-p13.3 by determination of the distribution of signals from 10 independent photographs.

    DISCUSSION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

In S. pombe, cell cycle checkpoint arrest in response to DNA damage or inhibition of replication is dependent on multiple proteins. Six gene products have been identified that act early in the process of checkpoint control, and to date human homologues of two of these proteins have been identified, Hrad9 (9) and ATR (7, 8). Based upon sequence homology and biochemical activity, we have identified a third component, Hrad1, a human homologue of he S. pombe rad1+ cell cycle checkpoint gene. Hrad1 is highly similar to S. pombe rad1+, S. cerevisiae RAD17, and the REC1 gene of U. maydis. Mutations in these genes lead to similar cell cycle checkpoint defects and other phenotypes associated with alterations in DNA repair and recombination (16, 19, 20).

We have shown that Hrad1 is subject to alternative splicing giving rise to two ORFs, a long form, designated Hrad1A, and an N-terminal truncation, designated Hrad1B. The Hrad1 gene has at least three transcripts of 5, 3, and 1.3 kb present in all tissues that we examined and that are increased in all the cancer cell lines examined, suggesting either that transcription of Hrad1 is proliferation-dependent or that it is increased in response to the genomic instability of cancer cell lines. In testis we observed an increase specifically in the 1.3-kb transcript. We have demonstrated that this transcript does not correspond to Hrad1A, suggesting that it corresponds to Hrad1B or an as yet unidentified third form of Hrad1. Several yeast cell cycle checkpoint genes play important roles in meiosis (39) and recently ATM and ATR (the human homologues of S. pombe rad3) were shown to be highly expressed in testis where they interact with meiotic chromosomes. This suggests a direct role for these proteins in recognizing and responding to DNA strand interruptions that occur during meiotic recombination (40). Hrad1 could form part of this recognition complex in association with ATM or ATR.

When expressed in an S. pombe rad1::ura4+ strain, both Hrad1A and Hrad1B failed to complement the phenotypes associated with loss of checkpoint function. However, this should not be taken as evidence against functional homology because failure to complement has been shown for other checkpoint genes such as ATR and Hchk1 (7, 12).2

The Hrad1 amino acid sequence is significantly similar to the U. maydis REC1 protein, indicating that Hrad1 may have a 3' right-arrow 5' exonuclease activity. We have confirmed the predicted 3' right-arrow 5' exonuclease activity for Hrad1A by demonstrating that Hrad1A expressed as a hexahistidine fusion protein and purified from E. coli is an exonuclease with a 6-fold preference for 3' termini. The biochemical properties of HisHrad1A were very similar to REC1 (21). The truncated Hrad1B, expressed as a hexahistidine fusion protein, lacks detectable exonuclease activity. This may reflect the in vivo biological activity or may be a consequence of the purification regimes. To fully address this question, purification of endogenous Hrad1B from mammalian cells or from a heterologous expression system that yields native protein will be required.

An analysis of C-terminal truncations of the Rec1 protein has established that the C-terminal portion of the Rec1 protein is not essential for exonuclease activity but is crucial for G2-M checkpoint function (24, 25). The checkpoint-compromised U. maydis rec1-1 mutant results from a C-terminal truncation lacking 122 amino acids (24), including a block of sequence containing four periodically spaced leucines that is conserved in Hrad1 and S. pombe Rad1 but not in S. cerevisiae RAD17 (24). This may represent a domain important in interactions with other checkpoint components. In addition, the rec1-5 mutant that lacks exonuclease activity has a 100-fold higher rate of spontaneous mutation, indicating that the exonuclease function may be required for mismatch repair (24). Thus, the Rec1 protein appears bifunctional, having an N-terminal exonuclease domain and a C-terminal checkpoint domain. This type of separation of enzymatic and checkpoint domains has also been described for S. cerevisiae DNA polymerase epsilon  (41). The bifunctional nature is likely to be conserved in Hrad1A based upon our biochemical studies and the protein sequence similarity between Hrad1A and the U. maydis Rec1 protein. However, in humans we have identified an additional component, Hrad1B, which corresponds to the C-terminal region of Rec1 implicated solely in checkpoint control. We cannot discount the possibility that the alternatively spliced mRNA coding for Hrad1B is not translated. However, if the Hrad1B mRNA leads to the production of a protein, then what role might it play in DNA metabolism or checkpoint control? In fission yeast, rad1 is required for both the DNA damage- and DNA replication-dependent checkpoints, whereas in S. cerevisiae RAD17 is only required for the DNA damage-dependent checkpoint. It has been demonstrated that RAD17 functions in conjunction with RAD24 and MEC1 to activate DNA degradation (23), leading to the suggestion that there is a requirement to process single- or double-stranded breaks such that single-stranded DNA is exposed to activate the checkpoint (22, 23). If we consider Hrad1 as part of a complex that acts as a surveillance mechanism monitoring the genome and communicating the presence of DNA damage or unreplicated DNA to the cell cycle machinery, then it is conceivable that in higher eukaryotes two types of surveillance complexes exist separating the DNA damage- and DNA replication-dependent checkpoint pathways. Hrad1A could be specifically required for the DNA damage-dependent checkpoint, able to monitor the genome via the C-terminal checkpoint domain and process single- and double-stranded breaks via the N-terminal exonuclease domain. A link between the mismatch repair system and the DNA damage-dependent checkpoint has been demonstrated (42). Hrad1B may have a function in the DNA replication-dependent checkpoint that might require only the monitoring activity and not the nuclease function to identify replication forks. Hrad1B also contains the sequence shown to be essential for checkpoint function in a mutational analysis of S. pombe Rad1 (43). The increase in transcription that we observed in testis could also signify a role for Hrad1B in meiotic recombination in conjunction with ATR and ATM.

The loss of checkpoint function has been shown to lead to genomic instability even in the absence of exogenous DNA damage (44). In humans, the p53 gene and the ATM gene are not only required for the G1-S phase checkpoint (45, 46) but also act as tumor suppressors (47-50). It is likely that other checkpoint genes will act as tumor suppressors. The Hrad1 gene is located on chromosome 5p13.2-13.3. Loss of heterozygosity of this region of chromosome 5 has been associated with a tumor suppressor function most notably in human lung cancer (37, 38). The CDK2/cyclin A-associated protein p45 (SKP2) has been mapped to 5p13 (51), but Hrad1 should also be considered as a candidate tumor suppressor gene in this region.

The precise roles that Hrad1A and Hrad1B play in cell cycle control, DNA repair, and tumor suppression remain to be determined. This study represents a starting point to begin to unravel the potential multiple roles for the Hrad1 gene product.

    ACKNOWLEDGEMENTS

We thank Jörg Sprengel for bioinformatics assistance, Grant Brown for providing S. pombe strains, George Brush, Grant Brown, Alan Richardson, and Paul Russell for their critical review of the manuscript, and the reviewer for helpful comments.

    FOOTNOTES

* The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

The nucleotide sequence(s) reported in this paper has been submitted to the GenBankTM/EMBL Data Bank with accession number(s) AJ004974, AJ004975, and AJ004976.

§ Present address: Cardiovascular Metabolism and Musculoskeletal Research Dept., Zeneca Pharmaceuticals, Alderley Edge, Cheshire, UK.

parallel To whom correspondence should be addressed. Tel.: 32-14-602618 or 32-14-605734; Fax: 32-14-606111; E-mail: wluyten{at}janbe.jnj.com.

1 The abbreviations used are: ORF, open reading frame; RACE, rapid amplification of cDNA ends; FISH, fluorescence in situ hybridization; DAPI, 4',6-diamidino-2-phenylindole; EST, expressed sequence tag; PCR, polymerase chain reaction; PMSF, phenylmethylsulfonyl fluoride; kb, kilobase pair(s).

2 A. Parker, unpublished results.

    REFERENCES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

  1. Hartwell, L. H., and Weinert, T. A. (1989) Science 246, 629-634[Abstract/Free Full Text]
  2. Hartwell, L. H., and Kastan, M. B. (1994) Science 266, 1821-1828[Abstract/Free Full Text]
  3. Elledge, S. J. (1996) Science 274, 1664-1672[Abstract/Free Full Text]
  4. Hartwell, L. (1992) Cell 71, 543-546[CrossRef][Medline] [Order article via Infotrieve]
  5. Carr, A. M., and Hoekstra, M. F. (1995) Trends Cell Biol. 5, 32-40[CrossRef][Medline] [Order article via Infotrieve]
  6. Savitsky, K., Bar-Shira, A., Gilad, S., Rotman, G., Ziv, Y., Vanagaite, L., Tagle, D. A., Smith, S., Uziel, T., Sfez, S., et al.. (1995) Science 268, 1749-1753[Abstract/Free Full Text]
  7. Bentley, N. J., Holtzman, D. A., Flaggs, G., Keegan, K. S., DeMaggio, A., Ford, J. C., Hoekstra, M., and Carr, A. M. (1996) EMBO J. 15, 6641-6651[Medline] [Order article via Infotrieve]
  8. Cimprich, K. A., Shin, T. B., Keith, C. T., and Schreiber, S. L. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 2850-2855[Abstract/Free Full Text]
  9. Lieberman, H. B., Hopkins, K. M., Nass, M., Demetrick, D., and Davey, S. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 13890-13895[Abstract/Free Full Text]
  10. Al-Khodairy, F., Fotou, E., Sheldrick, K. S., Griffiths, D. J., Lehmann, A. R., and Carr, A. M. (1994) Mol. Cell. Biol. 5, 147-160
  11. Furnari, B., Rhind, N., and Russell, P. (1997) Science 277, 1495-1497[Abstract/Free Full Text]
  12. Sanchez, Y., Wong, C., Thoma, R. S., Richman, R., Wu, Z., Piwnica-Worms, H., and Elledge, S. J. (1997) Science 277, 1497-1501[Abstract/Free Full Text]
  13. Peng, C-Y, Graves, P. R., Thoma, R. S., Wu, Z., Shaw, A. S., and Piwnica-Worms, H. (1997) Science 277, 1501-1505[Abstract/Free Full Text]
  14. Rhind, N., Furnari, B., and Russell, P. (1997) Genes Dev. 11, 504-511[Abstract/Free Full Text]
  15. Rowley, R, Subramani, S., and Young, P. G. (1992) EMBO J. 11, 1335-1342[Medline] [Order article via Infotrieve]
  16. Nasim, A., and Smith, B. P. (1975) Genetics 79, 573-582[Abstract/Free Full Text]
  17. Sunnerhagen, P., Seaton, B. L., Nasim, A., and Subramani, S. (1990) Mol. Cell. Biol. 10, 3750-3760[Abstract/Free Full Text]
  18. Long, K. E., Sunnerhagen, P., and Subramani, S. (1994) Gene (Amst.) 148, 155-159[CrossRef][Medline] [Order article via Infotrieve]
  19. Holden, D. W., Spanos, A., Kanuag, N., and Banks, G. R. (1991) Curr. Genet. 20, 145-150[CrossRef][Medline] [Order article via Infotrieve]
  20. Siede, W., Nusspaumer, G., Portillo, V., Rodriguez, R., and Friedberg, E. (1996) Nucleic Acids Res. 24, 1669-1675[Abstract/Free Full Text]
  21. Thelen, M. P., Onel, K., and Holloman, W. K. (1994) J. Biol. Chem. 269, 747-754[Abstract/Free Full Text]
  22. Carr, A. M. (1994) Int. J. Radiat. Biol. 66, (suppl.) 133-139
  23. Lydall, D., and Weinert, T. (1995) Science 270, 1488-1491[Abstract/Free Full Text]
  24. Onel, K., Thelen, M. P., Ferguson, D. O., Bennett, R. L., and Holloman, W. K. (1995) Mol. Cell. Biol. 15, 5329-5338[Abstract]
  25. Onel, K., Koff, A., Bennett, A. L., Unrau, P., and Holloman, W. K. (1996) Genetics 143, 165-174[Abstract]
  26. Altschul, S. F., Gish, W., Miller, W., Myers, E. W., and Lipman, D. J. (1990) J. Mol. Biol. 215, 403-410[CrossRef][Medline] [Order article via Infotrieve]
  27. Leupold, U. (1970) Methods Cell Physiol. 4, 169-177
  28. Maundrell, K. (1993) Gene (Amst.) 123, 127-130[CrossRef][Medline] [Order article via Infotrieve]
  29. Ito, H., Fukuda, Y., Murata, K., and Kimura, A. (1983) J. Bacteriol. 153, 163-168[Abstract/Free Full Text]
  30. Bhat, K. M., Sumner, I. G., Perry, B. N., Collins, M. E., Pickersgill, R. W., and Goodenough, P. W. (1991) Biochem. Biophys. Res. Commun. 176, 371-377[CrossRef][Medline] [Order article via Infotrieve]
  31. Heng, H. H. Q., Squire, J., and Tsui, L.-C. (1992) Proc. Natl. Acad. Sci. U. S. A. 89, 9509-9513[Abstract/Free Full Text]
  32. Heng, H. H. Q., and Tsui, L.-C. (1993) Chromosoma (Berl.) 102, 325-332[CrossRef][Medline] [Order article via Infotrieve]
  33. Heng, H. H. Q., and Tsui, L.-C. (1994) Methods Mol. Biol. 33, 35-49[Medline] [Order article via Infotrieve]
  34. Lee, M. G., and Nurse, P. (1987) Nature 327, 31-35[CrossRef][Medline] [Order article via Infotrieve]
  35. Lieberman, H. B., Hopkins, K. M., Nass, M., Demetrick, D., and Davey, S. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 13890-13895
  36. Devary, Y., Gottlieb, R. A., Smeal, T., and Karin, M. (1992) Cell 71, 1081-1091[CrossRef][Medline] [Order article via Infotrieve]
  37. Wieland, I., and Bohm, M. (1994) Cancer Res. 54, 1772-1774[Abstract/Free Full Text]
  38. Wieland, I., Bohm, M., Arden, K. C., Ammermuller, T., Bogatz, S., Viars, C. S., and Rajewsky, M. F. (1996) Oncogene 12, 97-102[Medline] [Order article via Infotrieve]
  39. Kato, R., and Ogawa, H. (1994) Nucleic Acids Res. 22, 3104-3112[Abstract/Free Full Text]
  40. Keegan, K. S., Holtzman, D. A., Plug, A. W., Christenson, E. R., Brainerd, E. E., Flaggs, G., Bentley, N. J., Taylor, E. M., Meyn, M. S., Moss, S. B., Carr, A. M., Ashley, T., and Hoekstra, M. (1996) Genes Dev. 10, 2423-2437[Abstract/Free Full Text]
  41. Navas, T. A., Zhou, Z., and Elledge, S. (1995) Cell 80, 29-39[CrossRef][Medline] [Order article via Infotrieve]
  42. Hawn, M. T., Umar, A., Carethers, J. M., Marra, G., Kunkel, T. A., Boland, R., and Koi, M. (1995) Cancer Res. 55, 3721-3725[Abstract/Free Full Text]
  43. Kanter-Smoler, G., Knudsen, K. E., Jimenez, G., Sunnerhagen, P., and Subramani, S. (1995) Mol. Biol. Cell 6, 1793-1805[Abstract]
  44. Weinert, T. A., and Hartwell, L. H. (1990) Mol. Cell. Biol. 10, 6554-6564[Abstract/Free Full Text]
  45. Yin, Y., Tainsky, M. A., Bischoff, F. Z., Strong, L. C., and Wahl, G. M. (1992) Cell 70, 937-948[CrossRef][Medline] [Order article via Infotrieve]
  46. Livingstone, L. R., White, A., Sprouse, J., Livanos, E., Jacks, T., and Tlsty, T. D. (1992) Cell 70, 923-935[CrossRef][Medline] [Order article via Infotrieve]
  47. Kastan, M. B., Onyekwere, O., Sidransky, D., Vogelstein, B., and Craig, R. W. (1991) Cancer Res. 51, 6304-6311[Abstract/Free Full Text]
  48. Kastan, M. B., Zhan, Q., el-Diery, W. S., Carrier, F., Jacks, T., Walsh, W. V., Plunkett, B. S., Vogelstein, B., and Fornace, A. J., Jr. (1991) Cell 71, 587-597
  49. Kuerbitz, S. J., Plunkett, B. S., Walsh, W. V., and Kastan, M. B. (1992) Proc. Natl. Acad. Sci. U. S. A. 89, 7491-7495[Abstract/Free Full Text]
  50. Dulic, V., Kaufmann, W. K., Wilson, S. J., Tlsty, T. D., Lees, E., Harper, J. W., Elledge, S., and Reed, S. I. (1994) Cell 76, 1013-1023[CrossRef][Medline] [Order article via Infotrieve]
  51. Demetrick, D. J., Zhang, H., and Beach, D. (1996) Cytogenet. Cell Genet. 73, 104-107[Medline] [Order article via Infotrieve]


Copyright © 1998 by The American Society for Biochemistry and Molecular Biology, Inc.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Cancer Res.Home page
M.-J. Chen, L. C. Dumitrache, D. Wangsa, S.-M. Ma, H. Padilla-Nash, T. Ried, and P. Hasty
Cisplatin Depletes TREX2 and Causes Robertsonian Translocations as Seen in TREX2 Knockout Cells
Cancer Res., October 1, 2007; 67(19): 9077 - 9083.
[Abstract] [Full Text] [PDF]


Home page
Nucleic Acids ResHome page
M.-J. Chen, S.-M. Ma, L. C. Dumitrache, and P. Hasty
Biochemical and cellular characteristics of the 3' -> 5' exonuclease TREX2
Nucleic Acids Res., April 10, 2007; (2007) gkm151v1.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
K. M. Hopkins, W. Auerbach, X. Y. Wang, M. P. Hande, H. Hang, D. J. Wolgemuth, A. L. Joyner, and H. B. Lieberman
Deletion of Mouse Rad9 Causes Abnormal Cellular Responses to DNA Damage, Genomic Instability, and Embryonic Lethality
Mol. Cell. Biol., August 15, 2004; 24(16): 7235 - 7248.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
D. Ma, J. R. McCorkle, and D. M. Kaetzel
The Metastasis Suppressor NM23-H1 Possesses 3'-5' Exonuclease Activity
J. Biol. Chem., April 23, 2004; 279(17): 18073 - 18084.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
K. M. Hopkins, X. Wang, A. Berlin, H. Hang, H. M. Thaker, and H. B. Lieberman
Expression of Mammalian Paralogues of HRAD9 and Mrad9 Checkpoint Control Genes in Normal and Cancerous Testicular Tissue
Cancer Res., September 1, 2003; 63(17): 5291 - 5298.
[Abstract] [Full Text] [PDF]


Home page
Mol. Biol. CellHome page
R. E. Jones, J. R. Chapman, C. Puligilla, J. M. Murray, A. M. Car, C. C. Ford, and H. D. Lindsay
XRad17 Is Required for the Activation of XChk1 But Not XCds1 during Checkpoint Signaling in Xenopus
Mol. Biol. Cell, September 1, 2003; 14(9): 3898 - 3910.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
E. A. Barnes, L. A. Porter, J.-L. Lenormand, R. W. Dellinger, and D. J. Donoghue
Human Spy1 Promotes Survival of Mammalian Cells following DNA Damage
Cancer Res., July 1, 2003; 63(13): 3701 - 3707.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Giannattasio, S. Sabbioneda, M. Minuzzo, P. Plevani, and M. Muzi-Falconi
Correlation between Checkpoint Activation and in Vivo Assembly of the Yeast Checkpoint Complex Rad17-Mec3-Ddc1
J. Biol. Chem., June 13, 2003; 278(25): 22303 - 22308.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
I. Hirai and H.-G. Wang
A Role of the C-terminal Region of Human Rad9 (hRad9) in Nuclear Transport of the hRad9 Checkpoint Complex
J. Biol. Chem., July 5, 2002; 277(28): 25722 - 25727.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
K. Yoshida, K. Komatsu, H.-G. Wang, and D. Kufe
c-Abl Tyrosine Kinase Regulates the Human Rad9 Checkpoint Protein in Response to DNA Damage
Mol. Cell. Biol., May 15, 2002; 22(10): 3292 - 3300.
[Abstract] [Full Text] [PDF]


Home page
Genes Dev.Home page
L. Zou, D. Cortez, and S. J. Elledge
Regulation of ATR substrate selection by Rad17-dependent loading of Rad9 complexes onto chromatin
Genes & Dev., January 15, 2002; 16(2): 198 - 208.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
L. A. Lindsey-Boltz, V. P. Bermudez, J. Hurwitz, and A. Sancar
Purification and characterization of human DNA damage checkpoint Rad complexes
PNAS, September 25, 2001; 98(20): 11236 - 11241.
[Abstract] [Full Text] [PDF]


Home page
Clin. Cancer Res.Home page
A. Kataoka, N. Sadanaga, K. Mimori, H. Ueo, G. F. Barnard, K. Sugimachi, D. Auclair, L. B. Chen, and M. Mori
Overexpression of HRad17 mRNA in Human Breast Cancer: Correlation with Lymph Node Metastasis
Clin. Cancer Res., September 1, 2001; 7(9): 2815 - 2820.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
M. Kai, H. Tanaka, and T. S.-F. Wang
Fission Yeast Rad17 Associates with Chromatin in Response to Aberrant Genomic Structures
Mol. Cell. Biol., May 15, 2001; 21(10): 3289 - 3301.
[Abstract] [Full Text]


Home page
Pharmacol. Rev.Home page
P. Perego, G. S. Jimenez, L. Gatti, S. B. Howell, and F. Zunino
Yeast Mutants As a Model System for Identification of Determinants of Chemosensitivity
Pharmacol. Rev., December 1, 2000; 52(4): 477 - 492.
[Abstract] [Full Text] [PDF]


Home page
Nucleic Acids ResHome page
H. Hang, S. J. Rauth, K. M. Hopkins, and H. B. Lieberman
Mutant alleles of Schizosaccharomyces pombe rad9+ alter hydroxyurea resistance, radioresistance and checkpoint control
Nucleic Acids Res., November 1, 2000; 28(21): 4340 - 4349.
[Abstract] [Full Text] [PDF]


Home page
Genes Dev.Home page
R. S. Weiss, T. Enoch, and P. Leder
Inactivation of mouse Hus1 results in genomic instability and impaired responses to genotoxic stress
Genes & Dev., August 1, 2000; 14(15): 1886 - 1898.
[Abstract] [Full Text]


Home page
Nucleic Acids ResHome page
C. Venclovas and M. P. Thelen
Structure-based predictions of Rad1, Rad9, Hus1 and Rad17 participation in sliding clamp and clamp-loading complexes
Nucleic Acids Res., July 1, 2000; 28(13): 2481 - 2493.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. Bessho and A. Sancar
Human DNA Damage Checkpoint Protein hRAD9 Is a 3' to 5' Exonuclease
J. Biol. Chem., March 10, 2000; 275(11): 7451 - 7454.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
J. G. Moggs, P. Grandi, J.-P. Quivy, Z. O. Jónsson, U. Hübscher, P. B. Becker, and G. Almouzni
A CAF-1-PCNA-Mediated Chromatin Assembly Pathway Triggered by Sensing DNA Damage
Mol. Cell. Biol., February 15, 2000; 20(4): 1206 - 1218.
[Abstract] [Full Text]


Home page
Mol. Cell. Biol.Home page
T. Caspari, M. Dahlen, G. Kanter-Smoler, H. D. Lindsay, K. Hofmann, K. Papadimitriou, P. Sunnerhagen, and A. M. Carr
Characterization of Schizosaccharomyces pombe Hus1: a PCNA-Related Protein That Associates with Rad1 and Rad9
Mol. Cell. Biol., February 15, 2000; 20(4): 1254 - 1262.
[Abstract] [Full Text]


Home page
J. Cell Sci.Home page
D Griffiths, M Uchiyama, P Nurse, and T. Wang
A novel mutant allele of the chromatin-bound fission yeast checkpoint protein Rad17 separates the DNA structure checkpoints
J. Cell Sci., January 3, 2000; 113(6): 1075 - 1088.
[Abstract] [PDF]


Home page
Cold Spring Harb Symp Quant BiolHome page
T. WEINERT, E. LITTLE, L. SHANKS, A. ADMIRE, R. GARDNER, C. PUTNAM, R. MICHELSON, K. NYBERG, and P. SUNDARESHAN
Details and Concerns Regarding the G2/M DNA Damage Checkpoint in Budding Yeast
Cold Spring Harb Symp Quant Biol, January 1, 2000; 65(0): 433 - 442.
[Abstract] [PDF]


Home page
Cold Spring Harb Symp Quant BiolHome page
R.S. WEISS, P. LEDER, and T. ENOCH
A Conserved Role for the Hus1 Checkpoint Protein in Eukaryotic Genome Maintenance
Cold Spring Harb Symp Quant Biol, January 1, 2000; 65(0): 457 - 466.
[Abstract] [PDF]


Home page
J. Biol. Chem.Home page
M.-S. Chang, H. Sasaki, M. S. Campbell, S.-K. Kraeft, R. Sutherland, C.-Y. Yang, Y. Liu, D. Auclair, L. Hao, H. Sonoda, et al.
HRad17 Colocalizes with NHP2L1 in the Nucleolus and Redistributes after UV Irradiation
J. Biol. Chem., December 17, 1999; 274(51): 36544 - 36549.
[Abstract] [Full Text] [PDF]


Home page
Microbiol. Mol. Biol. Rev.Home page
F. Paques and J. E. Haber
Multiple Pathways of Recombination Induced by Double-Strand Breaks in Saccharomyces cerevisiae
Microbiol. Mol. Biol. Rev., June 1, 1999; 63(2): 349 - 404.
[Abstract] [Full Text] [PDF]


Home page
Mol. Biol. CellHome page
R. P. St. Onge, C. M. Udell, R. Casselman, and S. Davey
The Human G2 Checkpoint Control Protein hRAD9 Is a Nuclear Phosphoprotein That Forms Complexes with hRAD1 and hHUS1
Mol. Biol. Cell, June 1, 1999; 10(6): 1985 - 1995.
[Abstract] [Full Text]


Home page
Cancer Res.Home page
S. Bao, M.-S. Chang, D. Auclair, Y. Sun, Y. Wang, W.-K. Wong, J. Zhang, Y. Liu, X. Qian, R. Sutherland, et al.
HRad17, a Human Homologue of the Schizosaccharomyces pombe Checkpoint Gene rad17, Is Overexpressed in Colon Carcinoma
Cancer Res., May 1, 1999; 59(9): 2023 - 2028.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
E. Volkmer and L. M. Karnitz
Human Homologs of Schizosaccharomyces pombe Rad1, Hus1, and Rad9 Form a DNA Damage-responsive Protein Complex
J. Biol. Chem., January 8, 1999; 274(2): 567 - 570.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. E. Parker, I. Van de Weyer, M. C. Laus, P. Verhasselt, and W. H. M. L. Luyten
Identification of a Human Homologue of the Schizosaccharomyces pombe rad17+ Checkpoint Gene
J. Biol. Chem., July 17, 1998; 273(29): 18340 - 18346.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
R. L. Cai, Y. Yan-Neale, M. A. Cueto, H. Xu, and D. Cohen
HDAC1, a Histone Deacetylase, Forms a Complex with Hus1 and Rad9, Two G2/M Checkpoint Rad Proteins
J. Biol. Chem., September 1, 2000; 275(36): 27909 - 27916.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. A. Burtelow, S. H. Kaufmann, and L. M. Karnitz
Retention of the Human Rad9 Checkpoint Complex in Extraction-resistant Nuclear Complexes after DNA Damage
J. Biol. Chem., August 18, 2000; 275(34): 26343 - 26348.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Rauen, M. A. Burtelow, V. M. Dufault, and L. M. Karnitz
The Human Checkpoint Protein hRad17 Interacts with the PCNA-like Proteins hRad1, hHus1, and hRad9
J. Biol. Chem., September 15, 2000; 275(38): 29767 - 29771.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M.-J. Chen, Y.-T. Lin, H. B. Lieberman, G. Chen, and E. Y.-H. P. Lee
ATM-dependent Phosphorylation of Human Rad9 Is Required for Ionizing Radiation-induced Checkpoint Activation
J. Biol. Chem., May 4, 2001; 276(19): 16580 - 16586.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
D. J. Mazur and F. W. Perrino
Structure and Expression of the TREX1 and TREX2 3'right-arrow5' Exonuclease Genes
J. Biol. Chem., April 27, 2001; 276(18): 14718 - 14727.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
D. J. Mazur and F. W. Perrino
Excision of 3' Termini by the Trex1 and TREX2 3'right-arrow5' Exonucleases. CHARACTERIZATION OF THE RECOMBINANT PROTEINS
J. Biol. Chem., May 11, 2001; 276(20): 17022 - 17029.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. A. Burtelow, P. M. K. Roos-Mattjus, M. Rauen, J. R. Babendure, and L. M. Karnitz
Reconstitution and Molecular Analysis of the hRad9-hHus1-hRad1 (9-1-1) DNA Damage Responsive Checkpoint Complex
J. Biol. Chem., July 6, 2001; 276(28): 25903 - 25909.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
H. Zhang, Z. Zhu, G. Vidanes, D. Mbangkollo, Y. Liu, and W. Siede
Characterization of DNA Damage-stimulated Self-interaction of Saccharomyces cerevisiae Checkpoint Protein Rad17p
J. Biol. Chem., July 6, 2001; 276(28): 26715 - 26723.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Parker, A. E.
Right arrow Articles by Luyten, W. H. M. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Parker, A. E.
Right arrow Articles by Luyten, W. H. M. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1998 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement