Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Oelkers, P.
Right arrow Articles by Sturley, S. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Oelkers, P.
Right arrow Articles by Sturley, S. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

J Biol Chem, Vol. 273, Issue 41, 26765-26771, October 9, 1998


Characterization of Two Human Genes Encoding Acyl Coenzyme A:Cholesterol Acyltransferase-related Enzymes*

Peter OelkersDagger §, Ajay BehariDagger , Debra Cromley, Jeffrey T. Billheimer, and Stephen L. SturleyDagger §parallel

From the Dagger  Institute of Human Nutrition, parallel  Departments of Pediatrics and Physiology and Molecular Biophysics, Columbia University College of Physicians and Surgeons, New York, New York 10032 and  DuPont Pharmaceutical Company, Experimental Station, Wilmington, Delaware 19880-0400

    ABSTRACT
Top
Abstract
Introduction
Procedures
Results
Discussion
References

The enzyme acyl coenzyme A:cholesterol acyltransferase 1 (ACAT1) mediates sterol esterification, a crucial component of intracellular lipid homeostasis. Two enzymes catalyze this activity in Saccharomyces cerevisiae (yeast), and several lines of evidence suggest multigene families may also exist in mammals. Using the human ACAT1 sequence to screen data bases of expressed sequence tags, we identified two novel and distinct partial human cDNAs. Full-length cDNA clones for these ACAT related gene products (ARGP) 1 and 2 were isolated from a hepatocyte (HepG2) cDNA library. ARGP1 was expressed in numerous human adult tissues and tissue culture cell lines, whereas expression of ARGP2 was more restricted. In vitro microsomal assays in a yeast strain deleted for both esterification genes and completely deficient in sterol esterification indicated that ARGP2 esterified cholesterol while ARGP1 did not. In contrast to ACAT1 and similar to liver esterification, the activity of ARGP2 was relatively resistant to a histidine active site modifier. ARGP2 is therefore a tissue-specific sterol esterification enzyme which we thus designated ACAT2. We speculate that ARGP1 participates in the coenzyme A-dependent acylation of substrate(s) other than cholesterol. Consistent with this hypothesis, ARGP1, unlike any other member of this multigene family, possesses a predicted diacylglycerol binding motif suggesting that it may perform the last acylation in triglyceride biosynthesis.

    INTRODUCTION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

The intracellular formation of sterol esters from fatty acid and sterol is mediated by acyl-CoA:cholesterol acyltransferase (ACAT).1 The pathological accumulation of cholesterol esters in atherosclerotic lesions has lead to intense pursuit of ACAT inhibitors as pharmacological agents. Microsomal ACAT preparations from various tissues display differential sensitivities to some of these agents (1) including histidine modifiers (2). This suggests that more than one protein mediates the esterification reaction, such as occurs in yeast (reviewed in Ref. 3). Saccharomyces cerevisiae (budding yeast) has two ACAT related enzymes, Are1 and Are2, which are derived from separate genes and have been shown to independently esterify sterols (4, 5). In terms of contribution to the sterol ester mass of the cell, Are1 is the minor isoform relative to Are2. These genes were identified based on sequence conservation to a human gene, ACAT1, which encodes an ACAT enzyme with homologs in many mammalian species (6, 7). The human ACAT1 gene encodes a 550-amino acid polypeptide and is expressed in most tissues, predominantly placenta, lung, kidney, and pancreas (6). ACAT1 has been predicted to have two transmembrane domains (6) and has been immunolocalized to the endoplasmic reticulum (8, 9). When murine ACAT1 was disrupted in induced mutant mice, homozygotes for the deletion were found to essentially lack ACAT activity in embryonic fibroblasts and have negligible amounts of cholesterol ester in the adrenal cortex and peritoneal macrophages (10). However, cholesterol ester accumulation was normal in hepatocytes while dietary cholesterol absorption, an indirect marker for intestinal cholesterol esterification, was indistinguishable from control littermates. This is consistent with the concept of a multigene family for this activity.

ACAT isoenzymes may be required to perform the variety of physiological roles mediated by cholesterol esterification. Increases in cellular free cholesterol above certain levels are cytotoxic and are ameliorated by cholesterol ester formation (11). In hepatocytes, the bulk of cholesterol secreted in very low density lipoprotein is esterified intracellularly and determines apolipoprotein B secretion rates (12-14). Cholesterol esterification in the enterocyte may be necessary for cholesterol absorption from the lumen and secretion in chylomicrons into the lymph (15). The formation of cholesterol ester stores could also provide a readily available substrate for steroid hormone synthesis in steroidogenic tissues (16, 17). It is likely that different ACAT isozymes mediate each of these processes, and the data presented here support that hypothesis.

We reasoned that additional human ACAT proteins would have sequence similarity to regions conserved between human ACAT1 and yeast Are1 and Are2. (4). Accordingly, an ACAT consensus sequence was used to screen the data base of expressed sequence tags (dbEST). Several cDNA entries were identified which were transcribed from two independent human genes. This study is a description of the isolation of full-length cDNA clones for two ACAT-related gene products (ARGP1 and ARGP2), examination of their pattern of tissue expression, and assays of enzymatic activity. We show that ARGP2 can catalyze the formation of sterol ester from cholesterol and oleoyl-CoA, leading us to rename this gene, ACAT2. By contrast, ARGP1 did not detectably esterify cholesterol and we propose that it performs acyl-CoA-dependent acylation of other molecules, such as diacylglycerol.

    EXPERIMENTAL PROCEDURES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

General-- Molecular biology techniques were performed by conventional protocols (18, 19) and DNA modifying reagents were purchased from Life Technologies, Inc., New England Biolabs, or Promega as indicated. The Prime It random priming probe synthesis kit was obtained from Stratagene. The DIG Genius probe synthesis kit and CSPD were supplied by Boerhinger Mannheim. Radioactive reagents ([14C]oleoyl-CoA and [32P]dCTP) were purchased from NEN Life Science Products Inc. Ethidium bromide-stained agarose gels were visualized by the Kodak Digital Science 1D system. Automated DNA sequencing was performed at the Columbia University Cancer Center sequencing facility, and oligonucleotides were synthesized by Genset. DNA and amino acid sequence analysis and comparisons were performed using DNAStrider (20), PILEUP, and GAP programs (GCG Inc. (21)), Prosite (22), and Identify (Ref. 23, website http://dna.stanford.edu/identify/). Yeast media components were prepared as described (18).

Screening the dbEST-- A 30-amino acid ACAT concensus peptide sequence (FAEMLRFGDRMFYKDWWNSTSYSNYYRTWN) was used as the query in a tblastn (which compares a protein sequence against a nucleotide sequence data base translated in all reading frames (24, 25)) search of the data base of expressed sequence tags at NCBLI (dbEST). Three clones, H24971, R07932, and R99213, derived from a common gene (named ACAT related gene product 1, ARGP1), were identified (p < 10-4). The entire human ACAT1 protein was then used in an identical search. In addition to clones of ACAT1 and ARGP1, two entries, R10272 and W76421, with significant similarity were identified (p < 10-5). They were derived from a gene we named ARGP2. Rescreening the dbEST with these clones identified two more ARGP2 entries. Escherichia coli clones with the largest inserts corresponding to these sequences were obtained from the I.M.A.G.E. consortium and resequenced with T3, T7, or gene specific primers.

5' Rapid Amplification of cDNA Ends (RACE) of ARGP1-- Oligo(dT) primed, double stranded cDNA was reverse transcribed from human, ileal, poly(A)+ mRNA, kindly provided by Dr. Paul Dawson, and ligated to adapters using a commercially available kit (CLONTECH, Palo Alto, CA). Touchdown PCR (26) was performed for 35 cycles with a forward primer complementary to the adapter (AP1, 5'-CCATCCTAATACGACTCACTATAGGGC) and a reverse primer (End4A, 5'-CCACCTGGAGCTGGGTGAAGAAC) complementary to the ARGP1 dbEST clone Z43867. The PCR mixture included 200 nM each oligo, 200 µM dNTPs, 1.75 mM MgCl2, 2.5 units of Taq, and the cDNA diluted 1:500. The 700-bp reaction product was gel isolated, ligated into YEp352 with a T overhang generated by Taq polymerase, and sequenced.

5' RACE of ARGP2-- A human, fetal (20 weeks post-conception) liver/spleen, oligo(dT)-primed, cDNA library in the vector pT7T3D was kindly provided by Dr. Bento Soares. PCR was performed with the cDNA, a forward primer (M13 reverse, 5'-TGAGCGGATAACAATTTCACACAGG) complementary to the vector and a reverse primer (203, 5'-CCCCATGCTGAGGTCTGTGATCAG), complementary to the ARGP2 dbEST clone R10272, using the above conditions. The 800-bp reaction product was gel isolated, ligated into pBS:SK (Stratagene) with a T overhang generated by Taq polymerase, and sequenced.

Hybridization Screening of a HepG2 cDNA Library-- A yeast expression library of HepG2 cDNA (size selected for inserts greater than 2.0 kb in pAB23BXN, commercially available from Austral Biologicals, San Ramon, CA), was propagated in the E. coli strain MC1061 and plated onto 135-mm LB + ampicillin (50 µg/ml) plates at an approximate density of 5000 colonies per plate. Membrane (Hybond-N, Amersham) replicas of the plates were probed by hybridization with a digoxigenin-labeled probe specific for ARGP1 (synthesized using a 420-bp NotI, PstI digestion product of the 5' RACE product) or ARGP2 (synthesized using the 5' RACE product) in 5 × SSC, 0.05% SDS, 0.1% N-laurolysarcosine, 0.1 mg/ml salmon sperm DNA, and 2% (w/v) blocking reagent (Boerhinger Mannheim) at 65 °C for 14-18 h. The membranes were washed in 0.2 × SSC, 0.1% SDS at 60 °C for 80 min, incubated with an anti-digoxigenin antibody (1:10,000), washed in Tris-buffered saline, incubated with the peroxidase substrate CSPD (Boerhinger Mannheim), and detected by enhanced chemiluminescence (ECL). For ARGP1, 4 single positive clones were isolated after screening ~20,000 clones. For ARGP2, 4 single positive clones were isolated after screening ~30,000 clones. The longest clones for each were sequenced multiple times on both strands using vector and gene-specific oligonucleotides.

Tissue Culture-- Cultured human Caco2, HeLa, HepG2, and THP1 cell lines were donated by Dr. R. J. Deckelbaum and originally obtained from the ATCC. HepG2, HeLa, and Caco2 cells were maintained as cell monolayers in Dulbecco's modified Eagle's medium (Life Technologies, Inc.) + 10% fetal bovine serum (HyClone) in 5% CO2. THP1 monocyte cells were maintained in suspension in RPMI (Life Technologies, Inc.) + 10% fetal bovine serum in 5% CO2. Differentiation of THP1 cells was stimulated with 150 ng/ml tetramyristate phorbol ester and 140 µM beta -mercaptoethanol. Whole cell RNA was isolated from confluent monolayer cultures or pelleted THP1 cells using TRIzol (Life Technologies, Inc.) extraction. The Caco2 cells had been confluent for approximately 21 days.

Human Adult and Fetal Multi-tissue Northern Blot Analysis-- Commercially obtained multi-tissue Northern blot (CLONTECH) contained 2 µg of poly(A)+ RNA from human adult or fetal (18-24 weeks postconception) tissues originally resolved on a 1.2% agarose, formaldehyde gel. The adult tissue membrane was hybridized with a random-hexamer primed, [32P]dCTP-labeled probe, generated using the insert of the ARGP1 dbEST clone R99213, in ExpressHyb buffer (CLONTECH) for 1 h at 68 °C. The membrane was washed in 0.1 × SSC, 0.5% SDS at 50 °C. After stripping the membrane was probed with ARGP2 (dbEST clone 10272 insert and the ARGP2 5' RACE product) using the conditions above. The fetal tissue Northern blot was hybridized with the same ARGP2 probe.

Reverse Transcription PCR-- Human cDNA obtained as part of a Quick Screen cDNA Panel of Human tissues (CLONTECH) or reverse transcribed (Life Technologies, Inc. kit) from human ileal poly(A)+ mRNA was used as the template in a PCR reaction with primers specific for ARGP1 (106, GGCATCCTGAACTGGTGTGTGGTG; 110, AGCTGGCATCAGACTGTGTCTGG), ARGP2 (202, GAGTTCCCCCACATTCATCAAATCC; 206, CATGCTGCTGCTCATCTTCTTTGCA), or beta -actin (Act1, GAGCTGCCTGACGGCCAGGTC; Act2, CACATCTGCTGGAAGGTGGACAG). The PCR mixture included 1.5 mM MgCl2, 200 µM dNTPs, 400 nM of each primer, and 2 units of Taq (Life Technologies, Inc.). Following 35 cycles (94 °C, 45 s; 60 °C, 45 s; 72 °C, 2 min), the products were resolved on a 1% agarose, 0.5 µg/ml ethidium bromide gel. For RNA prepared from human cultured cells, first strand cDNA synthesis was performed, with and without reverse transcriptase (SuperscriptII, Life Technologies, Inc.) using 4 µg of whole cell RNA. A fraction of each reaction (10%) was the template in a PCR reaction (30 cycles of 94 °C, 30 s; 68 °C, 2 min) with primers specific for ARGP1 (103, GCTTCATGGAGTTCTGGATGGTGG; 106, GGCATCCTGAACTGGTGTGTGGTG), ARGP2 (201, GACACCTCGATCTTGGTCCTGCC; 202, as above) or human ACAT1 (ACATa, CGGAATATCAAACAGGAGCCCTTC; ACATb, CATTCCAAAGAACATGAAGATGCACG).

In Vitro Assay of ACAT Activity in Yeast Microsomes-- The cDNA inserts of the longest ARGP1 and ARGP2 HepG2 library clones were removed by NotI, EcoRI digestion and ligated into the yeast expression vector pRS426GP which utilizes the galactose inducible GAL1/GAL10 promoter. A cDNA corresponding to the coding region of human ACAT1 flanked by 5 bp of 5'-untranslated region and 1 bp of 3'-untranslated region, in pRS426GP was described previously (27). Yeast strain, SCY059 (MATalpha , ade2-1, can1-1, trp1-1, ura3-1, his3-11, 15, leu2-3, 112, met14Delta 14HpaI-SalI, are1Delta NA::HIS3, are2Delta ::LEU2) with deletions in ARE1 and ARE2, the yeast homologs of human ACAT1 (4), was transformed with the above constructs or pRS426GP using lithium acetate and nucleic acid prototrophy selection (28). Expression of the constructs was verified by RT-PCR analysis of RNA isolated from the transformed cells. Culturing of the transformed yeast, induction of expression, microsome isolation, and sterol esterification assays were as described previously (27). In those experiments involving diethylpyrocarbonate (DEPC) to modify histidine residues, a preincubation with 100 µM DEPC was performed as described (2).

    RESULTS
Top
Abstract
Introduction
Procedures
Results
Discussion
References

Isolation of Full-length cDNA Clones for Two ACAT Related Human Genes-- A comparison of the human ACAT1 protein and the two yeast ACAT orthologs (Are1, Are2) identified a highly conserved (70% identical) region of 30 amino acids (ACAT1 amino acids 391-420) near the carboxyl terminus. This peptide was used to screen the data base of expressed sequence tags (dbEST). The search identified several human cDNAs, the longest being 890 bp (GenBank accession number H45923), derived from a common gene we call the ARGP1. To date, 26 clones for human ARGP1 are present in the dbEST from fetal liver/spleen, infant brain, breast, cerebellum, hippocampus, kidney, placenta, testis, ovary tumor, colon tumor, and lung tumor libraries, suggesting ubiquitous and abundant expression. In addition, ARGP1 is also represented as several murine entries (e.g. GenBank accession number C75990). The dbEST was then searched using the entire ACAT1 protein sequence. Four human cDNAs, distinct from ARGP1 cDNA clones, were identified in fetal liver/spleen and fetal heart libraries and are derived from a common gene we call ARGP2. The longest entry was 600 bp (GenBank accession number R10272). To date these are the only dbEST entries for human ARGP2, although several murine entries have been identified (e.g. GenBank accession number AA410072).

Northern blot analysis of human tissues (Figs. 3 and 4) showed that the initial dbEST clones for ARGP1 and ARGP2 were truncated, relative to the observed transcripts, by approximately 1000 and 1400 bp, respectively. To isolate full-length cDNA clones, 5' RACE was performed using cDNA synthesized from human liver (ARGP1) or ileal (ARGP2) mRNA but yielded only 600 nucleotides of novel sequence for each. The respective 5' RACE products were then used as probes to screen a size selected (>2.0 kb), HepG2 cDNA library by hybridization. The longest ARGP1 clone contained 1976 nucleotides and a 130-base poly(A)+ tract which agreed with the length of the minimal ARGP1 transcript detected by Northern blot (Fig. 3). HepG2 cells express only the 2.0-kb ARGP1 transcript.2 A similar approach identified ARGP2 clones, the longest of which contained 2040 bp of sequence with a 50-base poly(A)+ tract in accordance with the observed length of the ARGP2 transcript (Fig. 4).

ARGP1 Predicted Peptide-- The longest open reading frame of ARGP1, flanked by a 244 nucleotide 5'-untranslated region and a 265-nucleotide 3'-untranslated region, encodes a 488-amino acid protein (Fig. 1) with a calculated molecular mass of 55,216 daltons. The predicted initiator methionine lies within a consensus for initiation of translation (29) and downstream of an in-frame termination codon. Comparison to ACAT1 revealed 22% amino acid sequence identity (29% similarity) over the entire molecule. The conservation of these molecules is greatest toward the COOH terminus, such that ACAT1 and ARGP1 are 28% identical over the last 250 residues. This pattern of sequence similarity is strikingly similar to that observed from comparison of ACAT1 with the yeast Are1 and Are2 proteins. ARGP1 is predicted to be a membrane bound protein with nine putative transmembrane domains and one N-linked glycosylation site. Uniquely, ARGP1 contains a diacylglycerol/phorbol ester binding signature sequence (H.[FWY]..[KR].F..P) at amino acids 382-392 which was originally identified by comparison of protein kinase C isoforms and diacylglycerol kinases (Fig. 7) (36, 37)). This motif is also conserved in the murine homolog of ARGP1 residing at the dbEST (GenBank accession number AA764382).


View larger version (31K):
[in this window]
[in a new window]
 
Fig. 1.   ARGP1 predicted peptide sequence. A 1976-bp ARGP1 cDNA clone was identified by colony hybridization screening of a HepG2 cDNA library. Translation of this clone predicts the 488-amino acid peptide shown. The residues in bold are conserved with human ACAT1. The underlined portions are predicted transmembrane domains, a potential N-linked glycosylation site is boxed, and a putative tyrosine phosphorylation motif is in brackets. The sequence has been deposited at GenBank, accession number AF059202.

ARGP2 Predicted Peptide-- The longest ARGP2 open reading frame, flanked by a 51-nucleotide 5'-untranslated region and a 420-nucleotide 3'-untranslated region, predicts a 522-amino acid protein with a calculated molecular mass of 59,942 daltons (Fig. 2). The predicted initiator methionine lies within a consensus for initiation of translation (29). Over the entire molecule, the predicted protein is 47% identical (54% similar) to human ACAT1. This conservation is even more pronounced at the COOH-terminal end of the molecules, raising to 63% identity over the last 250 residues. ARGP2 is predicted to be a membrane bound protein with seven putative transmembrane domains and two N-linked glycosylation sites. ARGP2 is similar to ACAT1 in that it contains a leucine zipper (338-359) which may mediate multimerization or interaction with other proteins. ARGP2 does not possess a predicted diacylglycerol/phorbol ester-binding site. A sequenced tag entry (number WI-11660) for ARGP2 localizes to human chromosome 12, further distinguishing it from ACAT1, which is located on chromosome 1 (30).


View larger version (33K):
[in this window]
[in a new window]
 
Fig. 2.   ARGP2 predicted peptide sequence. A 2040-bp ARGP2 cDNA isolated by screening a HepG2 cDNA predicts the 522-amino acid polypeptide shown. The residues in bold are conserved with human ACAT1. The underlined portions are predicted transmembrane domains, two potential N-linked glycosylation sites are boxed, a putative tyrosine phosphorylation motif is in brackets, and the circles mark the leucine zipper heptad motif. The sequence has been deposited at GenBank, accession number AF059203.

ARGP1 and ARGP2 Expression in Human Tissues and Tissue Culture Cell Lines-- Expression of a second ACAT would be expected in tissues (e.g. liver and intestine) which exhibit normal ACAT activity in the induced mutant ACAT1 (acact-) mice (10). Expression of ARGP1 and ARGP2 was thus examined by Northern blot of human RNA (Figs. 3 and 4). Hybridization of an ARGP1 cDNA probe to a panel of adult tissue mRNAs detected a transcript in all tissues examined (Fig. 3). However, ARGP1 expression levels varied qualitatively among tissues with moderate expression in thyroid, stomach, heart, skeletal muscle, and liver and high expression in adrenal cortex, adrenal medulla, testes, and small intestine. The presence of a 2.0-kb transcript was invariable among the tissues while a 2.4-kb transcript was observed in about half the tissues, most notably the tissues with high expression. The origin of these two transcripts has not been identified, however, their heterogeneity is unlikely to lie at the 3' end of the message since all dbEST entries for ARGP1 cDNAs terminate at a similar position. Hybridization of the same membrane, under identical conditions, with an ARGP2 cDNA probe failed to detect a transcript in any tissue (data not shown). Since the four ARGP2 dbEST clones were in human fetal libraries, ARGP2 expression was examined in human fetal tissues by Northern blot (Fig. 4). A 2.2-kb transcript was detected in fetal liver but not in fetal brain, lung, or kidney.


View larger version (41K):
[in this window]
[in a new window]
 
Fig. 3.   Northern blot analysis of ARGP1 expression in human adult tissues. 2 µg of mRNA from human adult tissues (panel A, CLONTECH MTN I; and panel B, endocrine system MTN) was hybridized with a [32P]dCTP, random-hexamer labeled, human ARGP1 probe in Express Hyb solution for 1 h at 68 °C. After washing in 0.2 × SSC, 0.1% SDS at 60 °C for 40 min, the membranes were exposed to x-ray film. Molecular weight markers were as supplied by CLONTECH.


View larger version (93K):
[in this window]
[in a new window]
 
Fig. 4.   Northern blot analysis of ARGP2 expression in human fetal tissues. 2 µg of mRNA from human fetal tissues (CLONTECH Fetal MTN II) was resolved on a denaturing, 1.2% agarose gel, transferred to a nylon membrane, and hybridized with a [32P]dCTP, random-hexamer labeled, human ARGP2 probe in Express Hyb solution for 1 h at 65 °C. After washing in 0.2 × SSC, 0.1% SDS at 68 °C for 40 min, the membranes were exposed to x-ray film. Molecular weight markers were as supplied by CLONTECH.

To further examine the expression of ACAT2 in adults, a RT-PCR was performed using cDNA generated from a variety of tissues (Fig. 5). As shown, ARGP2 is expressed in human adult heart, kidney, liver, lung, pancreas, and ileum. The identity of the PCR product was verified by Southern blotting and hybridization with an ARGP2-specific cDNA probe (data not shown). An RT-PCR analysis of ARGP1 on these same samples gave a similar pattern of expression to that determined by the Northern blot in Fig. 3.


View larger version (72K):
[in this window]
[in a new window]
 
Fig. 5.   Analysis of ARGP1 and ARGP2 expression in adult human tissues using RT-PCR. PCR was performed as described using a Quick Screen Human cDNA Panel (CLONTECH), or cDNA reverse transcribed from human ileal poly(A)+ mRNA, and primers specific for ARGP1, ARGP2, or beta -actin in a standard PCR mixture. The PCR products, predicted to be 921 (ARGP1), 844 (ARGP2), or 835 (beta -actin) bp, were resolved on ethidium bromide-stained agarose gels with a 100-bp DNA ladder (L; Life Technologies, Inc.).

ARGP1 and ARGP2 expression in human tissue culture cell lines was also examined by RT-PCR (Fig. 6). ARGP1 was expressed in cell culture models for human endothelial (HeLa), hepatocyte (HepG2), monocyte (undifferentiated THP1), macrophage (differentiated THP1), and intestinal epithelial (Caco2) cells. Expression of ARGP2 was limited to HepG2 and Caco2 cells. This reinforces the concept that ARGP1 is widely expressed while the expression of ARGP2 is more restricted. ACAT1 was expressed in all of these cell lines confirming previous observations (7, 31) (data not shown).


View larger version (63K):
[in this window]
[in a new window]
 
Fig. 6.   Analysis of ARGP1 and ARGP2 expression in tissue culture cells using RT-PCR. Monolayer cultures of HeLa, HepG2, undifferentiated THP1, and Caco2 tissue culture cells were grown as described under "Experimental Pprocedures." THP1 cells were differentiated into macrophages by the addition of phorbol ester. Total cellular RNA was isolated from the cells and reverse transcribed using oligo(dT) priming in parallel with reactions which lacked RT enzyme. Oligonucleotide pairs complementary to ARGP1 or ARGP2 were included in a PCR using the conditions described in the legend to Fig. 5. The PCR products, predicted to be 667 (ARGP1) and 352 (ARGP2) bp, were resolved on an ethidium bromide-stained agarose gel alongside a 100-bp DNA ladder (L; Life Technologies, Inc.).

Assay of ACAT Activity in ACAT Negative Yeast Transformed with ARGP1 and ARGP2-- The ability of ARGP1 and ARGP2 to esterify sterols was assayed in a sterol esterification deficient yeast strain (SCY059) in which the endogenous ARE genes were deleted (27). Microsomes from these yeast, transformed with an expression vector harboring no insert or cDNA inserts for ARGP1, ARGP2, or human ACAT1 were assayed in vitro for the incorporation of [14C]oleate into sterol ester. Since we previously demonstrated that cholesterol is the preferred substrate for mammalian ACAT enzymes (27, 32), assays were performed with exogenous cholesterol supplied in Triton WR-1339. As shown in Table I, ARGP2 forms cholesterol ester at a rate of 49 pmol/min/mg of microsomal protein. This is 24-fold over background and about 15% of the activity detected in microsomes from ACAT1 transformants. We therefore renamed ARGP2 as ACAT2. ARGP1 did not display significant ACAT activity. None of the enzymes showed the ability to use ergosterol, the major sterol in yeast microsomes, as a substrate (data not shown). While the ACAT1 and ACAT2 mediated activities were equally sensitive (75% inhibition) to the ACAT inhibitor Dup128 (0.5 µM; not shown), they showed significantly different sensitivity to the histidine/tyrosine modifying agent diethylpyrocarbonate (DEPC, Table I). This reagent was previously demonstrated to distinguish liver and adrenal ACAT activities, the latter being significantly more sensitive. Since adrenal ACAT would primarily represent ACAT1, our data are consistent with ACAT2 representing the DEPC-resistant isoform identified by Kinnunen et al. (2).

                              
View this table:
[in this window]
[in a new window]
 
Table I
In vitro analysis of ACAT activity of transformed yeast
S. cerevisiae strain SCY059 (are1are2) was transformed with the yeast expression vector pRS426GP harboring either no insert or cDNAs encoding human ACAT1, ARGP1, or ARGP2. Expression was under the control of the inducible GAL1/10 promoter. Microsomes were isolated from galactose induced yeast cultures and incubated in 0.1 M sodium phosphate, 1 mM glutathione, 20 nM [14C]oleate, with exogenous cholesterol (260 µM in Triton WR-1339) for 3 minutes at 37 °C. The amount of radioactivity incorporated into sterol ester was determined by thin layer chromatography and scintillation counting as described. In those experiments involving DEPC, microsomes were preincubated at room temperature in the presence or absence of 100 µM DEPC for 30 min prior to the ACAT assay. Data are pmol cholesteryl oleate formed per min/mg of protein expressed as mean ± S.E. from at least three different experiments on different preparations or of a representative experiment performed in triplicate.

    DISCUSSION
Top
Abstract
Introduction
Procedures
Results
Discussion
References

We have isolated two independent human cDNAs, ARGP1 and ACAT2, which encode proteins with significant sequence similarities to human ACAT1. The level of nucleotide sequence conservation between ACAT1 and ACAT2 (55%) suggests their common evolution possibly arising from a gene duplication event, as clearly occurred in the case of the yeast ARE gene family. However, ARGP1 is more distantly related, bearing 39 and 43% nucleotide identity with ACAT1 and ACAT2, respectively, and may have evolved independently. The uniform similarity between the human genes and the two yeast ARE genes precludes any assignment of lineage across species.

The similarity among the three human ACAT-like proteins is most distinct over their COOH-terminal regions just as is the case when comparing the yeast Are proteins to ACAT1. The predicted ARGP1 protein displays 28% identity with ACAT1 over this portion of the molecule and includes a FY.DWWN motif present in all cloned ACATs and shown to be important for enzymatic activity (Fig. 7A).3 However, ARGP1 is the most divergent member of this gene family. For example, a HSF motif (residues 268-270) is invariant in ACAT1 and yeast Are enzymes and was critical to ACAT1 activity in CHO cells. Replacement of Ser by Leu produced an inactive and unstable molecule (33). This motif is not conserved in ARGP1, although several serines are present in the region (e.g. Ser227, Fig. 7B). ARGP1 is also unique in its predicted possession of a diacylglycerol/phorbol ester-binding site (Fig. 7A), leading us to speculate that this enzyme might esterify diacylglycerol to produce triglyceride. Sequence similarity between diacylglycerol acyltransferase and ACAT enzymes might be expected since both have a common substrate, acyl-CoA, but differ in the alcohol (cholesterol or diacylglycerol) used as a second substrate.


View larger version (31K):
[in this window]
[in a new window]
 
Fig. 7.   Consensus sequences in the ACAT multigene family. Two regions of structural and functional conservation are shown. The amino acid position of each initial residue is shown. Uppercase residues indicate those of the consensus calculated with a plurality of 2. A, The DWWN region. The FY.DWWN motif is invariant in all members identified to date of this gene family, the tyrosine and tryptophans being critical to activity.3 In all but ARGP1, the Tyr constitutes a candidate target for phosphorylation (indicated in bold and by pi ). In ARGP1, the underlined sequence HKWCIRHFYKP represents a candidate for diacylglycerol binding as found in protein kinase C and diacylglycerol kinases (motif, H.[FWY]..[KR].F..P). The asterisks identify those residues critical to definition of this motif that distinguish ARGP1 from the other members of the family. B, the HSF region. The central serine residue (indicated sigma ) was found to be critical to the activity and stability of Chinese hamster ovary ACAT1.

Of the two new gene products described here, ACAT2 displays significantly greater sequence similarity to ACAT1, with an overall identity of 47% and 63% invariance over the COOH-terminal half of the molecules. The FY.DWWN motif common to this family of proteins is maintained in ACAT2 to the extent that the flanking residues render the tyrosine a candidate for phosphorylation as observed in ACAT1 and in yeast (Fig. 7A). Tyrosine phosphorylation may be a regulator of ACAT activity, although serine and threonine phosphorylation is unlikely to be involved (34, 35). The HSF motif found in ACAT1, Are1 and Are2 is conservatively replaced in ACAT2 by YSF (residues 244-246; Fig. 7B). Interestingly, histidine modifying agents selectively inactivate adrenal microsomal ACAT activity but display a significantly higher Ki (1500 versus 250 µM) against liver microsomes (2). It is intriguing to speculate that sequence variation in the (H/Y)SF motif may explain this observation. In accordance with this, we showed that ACAT1 was significantly more sensitive to DEPC than ACAT2. In common with ACAT1, Are1 and Are2, the ACAT2 sequence predicts a leucine heptad motif which may play a role in multipeptide complex formation. Radiation inactivation studies in rat liver microsomes have shown that the ACAT enzymatic complex is about 200 kDa (36, 37), much larger than the predicted monomer for ACAT 1 (65 kDa) or ACAT2 (60 kDa). There is also evidence that ACAT1 interacts with itself in a yeast two-hybrid system (38) and ACAT2 may be similar in this regard. ARGP1 and ACAT2 are also similar to ACAT1 in terms of hydrophobicity. While previous studies suggested that ACAT1 contains two transmembrane domains (6), the PredictProtein algorithm (39) indicates eight such domains in ACAT1, similar to the number predicted for ARGP1 (nine) and ACAT2 (seven). Membrane spanning domains are expected characteristics of ACAT and diacylglycerol acyltransferase enzymes since both activities are associated with microsomal membranes (40-42).

In addition to sequence similarity with ACAT1, we expect alternate ACAT enzymes to be expressed in the tissues which retain ACAT activity in the induced mutant ACAT1 mouse, namely the liver and intestine. ARGP1 met this criteria, however, it is also highly expressed in human adult adrenal cortex which was depleted of cholesterol esters in the induced mutant mouse. Monocytes from acact- mice were also devoid of cholesterol ester and yet ARGP1 mRNA was detected in the human THP1 monocyte cell line. This evidence is contrary to ARGP1 being an ACAT, barring species-specific differences in expression. By the sensitive technique of RT-PCR, ACAT2 expression was observed in human adult liver and intestine and in cell culture models of the hepatocyte and intestinal enterocyte but was undetectable in THP1 monocytes and macrophages. This profile of expression is consistent with a role for ACAT2 in the livers and intestine of mammals, particularly ACAT1 knockout mice.

In confirmation of ACAT2 being a candidate for a second ACAT, heterologous expression of ACAT2 in an ACAT-negative yeast strain conferred significant microsomal cholesterol esterification with oleoyl-CoA at a level comparable to the 20-50 pmol/min/mg of protein observed in human liver microsomes supplied with exogenous cholesterol (43). The ACAT2-mediated esterification activity was significantly (85%) less than that mediated by ACAT1 in yeast. This may be due to differences in protein expression (although both mRNAs were produced at high levels as detected by RT-PCR, data not shown), protein stability, or a genuine difference between the two enzymes.

Liver ACAT, predicted to comprise both ACAT1 and ACAT2, utilizes a limited range of sterol substrates but a wide variety (16:0, 18:0, 18:1, 18:2, and 20:4) of fatty acyl-CoAs (27, 44). Determining substrate-specific differences between ACAT1 and ACAT2 may thus explain their redundancy. The redundancy may also be related to substrate affinity such as seen between the hexokinase types I-III and hexokinase type IV (glucokinase) (45). In such a scenario, one ACAT would have a lower affinity for cholesterol and only catalyze esterification at high cholesterol concentrations.

In addition to potential differences in activity, the two enzymes may have different physiological roles. For storage, cholesterol esters concentrate as cytoplasmic neutral lipid droplets, whereas for lipoprotein synthesis, cholesterol esters are incorporated into lipoprotein particles in the endoplasmic reticulum lumen. Redundant ACAT enzymes might allow one to be specific for cytoplasmic release of the cholesterol ester product and another to mediate endoplasmic reticulum lumenal release. Since lipoprotein synthesis occurs primarily in the liver and intestine, we speculate that ACAT2 may release cholesterol ester into the endoplasmic reticulum lumen, leaving ACAT1 to esterify and store sterols in the cytoplasm. The large amount of cholesterol ester, likely as cytoplasmic droplets, in the livers of high fat, high cholesterol fed acact- mice, is contrary to this hypothesis. Alternatively, ACAT2's role may be important in the fetus since it was easily detected by Northern blot in human fetal liver.

The abundance of ARGP1 entries in the dbEST from a wide variety of cDNA libraries is reflective of the ubiquitous nature of ARGP1 expression in human adult tissues and tissue culture cell lines. This suggests that ARGP1 serves a function important to many cell types. Expression of two independent clones of ARGP1 under the regulation of two yeast promoters, GAL1/10 and GAPDH (not shown), failed to detectably esterify cholesterol or ergosterol. ARGP1-specific mRNA was identified by RT-PCR in each case. We take this as further evidence that unlike ACAT1 and ACAT2, ARGP1 is not involved in cholesterol esterification, at least when expressed in yeast. Based on the conservation of amino acids in ARGP1 that are important for ACAT1 to be active, ARGP1 likely catalyzes a reaction similar to ACAT. Other esterification reactions which use fatty-acyl CoAs as substrates include retinol esterification, methyl ester formation, triterpene esterification, monoacylglycerol transferase, and diacylglycerol transferase. In the latter case our observations of a diacylglycerol-binding site in ARGP1 biases us to the possibility of ARGP1 being diacylglycerol acyltransferase, which to date has not been isolated at the molecular level. We are presently investigating whether ARGP1 can mediate these reactions.

    ACKNOWLEDGEMENTS

We are grateful to Dr. B. Soares for helpful advice, Fanny Keyserman for technical assistance, and Dr. J. J. Rich for advice regarding this manuscript.

    FOOTNOTES

* This work was supported in part by a Grant-in-Aid/Investigatorship from the American Heart Association (NYC Affiliate) and by the Ara Parseghian Medical Research Foundation (to S. L. S.).The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

The nucleotide sequence(s) reported in this paper has been submitted to the GenBankTM/EMBL Data Bank with accession number(s) AF059202 and AF059203.

§ Supported by NHLBI, National Institutes of Health, Training Fellowship HL07343 in Arteriosclerosis.

parallel Established investigator of the American Heart Association. To whom correspondence should be addressed: Institute of Human Nutrition, Columbia University College of Physicians and Surgeons, 650 W. 168th St., New York, NY 10032. Tel.: 212-305-6304; Fax: 212-305-3079; E-mail: sls37{at}columbia.edu.

The abbreviations used are: ACAT, acyl coenzyme A:cholesterol acyltransferase; ARGP, ACAT related gene product; RACE, rapid amplification of cDNA ends; PCR, polymerase chain reaction; bp, base pair(s); kb, kilobase pair(s); RT, reverse transcriptase; DEPC, diethylpyrocarbonate.

2 T. Seo, P. Oelkers, M. Giattina, R. J. Deckelbaum, and S. L. Sturley, manuscript in preparation.

3 Z. Guo, D. Cromley, J. T. Billheimer, and S. L. Sturley, manuscript in preparation.

    REFERENCES
Top
Abstract
Introduction
Procedures
Results
Discussion
References

  1. Maduskie, T., Billheimer, J., Germain, S., Gillies, P., Higley, C., Johnson, A., Pennev, P., Shimshick, E., and Wexler, R. (1995) J. Med. Chem. 38, 1067-1083[CrossRef][Medline] [Order article via Infotrieve]
  2. Kinnunen, P. M., DeMichele, A., and Lange, L. G. (1988) Biochemistry 27, 7344-50[CrossRef][Medline] [Order article via Infotrieve]
  3. Sturley, S. L. (1997) Curr. Opin. Lipidol. 8, 167-173[Medline] [Order article via Infotrieve]
  4. Yang, H., Bard, M., Bruner, D. A., Gleeson, A., Deckelbaum, R. J., Aljinovic, G., Pohl, T., Rothstein, R., and Sturley, S. L. (1996) Science 272, 1353-1356[Abstract]
  5. Yu, C., Kennedy, N. J., Chang, C. C. Y., and Rothblatt, J. A. (1996) J. Biol. Chem. 271, 24157-24163[Abstract/Free Full Text]
  6. Chang, C. C. Y., Huh, H. Y., Cadigan, K. M., and Chang, T. Y. (1993) J. Biol. Chem. 268, 20747-20755[Abstract/Free Full Text]
  7. Uelman, P. J., Oka, K., Sullivan, M., Chang, C. C. Y., Chang, T. Y., and Chan, L. (1995) J. Biol. Chem. 270, 26192-26201[Abstract/Free Full Text]
  8. Chang, C. C., Chen, J., Thomas, M. A., Cheng, D., Del Priore, V. A., Newton, R. S., Pape, M. E., and Chang, T.-Y. (1995) J. Biol. Chem. 270, 29532-29540[Abstract/Free Full Text]
  9. Tabas, I., Zha, X., Maxfield, F., Chang, T.-Y., Beatini, N., Farese, R. V., and Meiner, V. (1996) Circulation 94, I-35
  10. Meiner, V. M., Cases, S., Myers, H., Sande, E. R., Bellosta, S., Schambelan, M., Pitas, R. E., McGuire, J., Herz, J., and Farese, R. V. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 14041-14046[Abstract/Free Full Text]
  11. Warner, G. J., Stoudt, G., Bamberger, M., Johnson, W. J., and Rothblatt, G. H. (1995) J. Biol. Chem. 270, 5772-5778[Abstract/Free Full Text]
  12. Carr, T. P., Parks, J. S., and Rudel, L. L. (1992) Arterioscler. Thromb. 12, 1275-1283
  13. Huff, M. W., Telford, D. E., Barrett, P. H. R., Billheimer, J. T., and Gillies, P. J. (1994) Arterioscler. Thromb. 14, 1498-1508[Abstract/Free Full Text]
  14. Carr, T. P., Hamilton, R. L. J., and Rudel, L. L. (1995) J. Lipid Res. 36, 25-36[Abstract]
  15. Field, F. J., Kam, N. T., and Mathur, S. N. (1990) Gastroenterology 99, 539-551[Medline] [Order article via Infotrieve]
  16. Veldhuis, J. D., Strauss, J. F. d., Silavin, S. L., and Kolp, L. A. (1985) Endocrinology 116, 25-30[Abstract/Free Full Text]
  17. Civen, M., Leeb, J., and Morin, R. J. (1982) J. Steroid Biochem. 16, 817-822[CrossRef][Medline] [Order article via Infotrieve]
  18. Ausubel, F. M., Brent, R., Kingston, R. E., Moore, D. D., Seidman, J. G., Smith, J. A., and Struhl, K. (1987) Current Protocols in Molecular Biology, Vols. 1 and 2, John Wiley & Sons, New York
  19. Maniatis, T., Fritsch, E. F., and Sambrook, J. (1987) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Lab., Cold Spring Harbor, NY
  20. Marck, C. (1988) Nucleic Acids Res. 16, 1829-1836[Abstract/Free Full Text]
  21. Devereux, J., Haeberli, P., and Smithies, O. (1984) Nucleic Acids Res. 12, 387-395
  22. Bairoch, A., Bucher, P., and Hofmann, K. (1997) Nucleic Acids Res. 25, 217-221[Abstract/Free Full Text]
  23. Nevill-Manning, C. G., Wu, T. D., and Brutlag, D. L. (1998) Proc. Natl. Acad. Sci. U. S. A. 95, 5865-5871[Abstract/Free Full Text]
  24. Altschul, S. F., Gish, W., Miller, W., Myers, E. W., and Lipman, D. J. (1990) J. Mol. Biol. 215, 403-410[CrossRef][Medline] [Order article via Infotrieve]
  25. Altschul, S. F., Madden, T. L., Schaffer, A. A., Zhang, J., Zhang, Z., Miller, W., and Lipman, D. J. (1997) Nucleic Acids Res. 25, 3389-3402[Abstract/Free Full Text]
  26. Don, R. H., Cox, P. T., Wainwright, B. J., Baker, K., and Mattick, J. S. (1991) Nucleic Acids Res. 19, 4008[Free Full Text]
  27. Yang, H., Cromley, D., Wang, H., Billheimer, J. T., and Sturley, S. L. (1997) J. Biol. Chem. 272, 3980-3985[Abstract/Free Full Text]
  28. Ito, H., Fukuda, Y., Murata, K., and Kimura, A. (1983) J. Bacteriol. 153, 163-168[Abstract/Free Full Text]
  29. Kozak, M. (1989) J. Cell Biol. 108, 229-241[Abstract/Free Full Text]
  30. Chang, C. C., Noll, W. W., Nutile-McMenemy, N., Lindsay, E. A., Baldini, A., Chang, W., and Chang, T. Y. (1994) Somatic Cell Mol. Genet. 20, 71-74[CrossRef][Medline] [Order article via Infotrieve]
  31. Matsuda, H., Hakamata, H., Miyazaki, A., Sakai, M., Chang, C. C., Chang, T. Y., Kobori, S., Shichiri, M., and Horiuchi, S. (1996) Biochim. Biophy. Acta 1301, 76-84[Medline] [Order article via Infotrieve]
  32. Tavani, D. M., Nes, W. R., and Billheimer, J. T. (1982) J. Lipid Res. 23, 774-781[Abstract]
  33. Cao, G., Goldstein, J. L., and Brown, M. S. (1996) J. Biol. Chem. 271, 14642-14648[Abstract/Free Full Text]
  34. Botham, K. M. (1992) Biochem. Soc. Trans. 20, 454-459[Medline] [Order article via Infotrieve]
  35. Corton, J. M., and Hardie, D. G. (1992) Eur. J. Biochem. 204, 203-208[Medline] [Order article via Infotrieve]
  36. Billheimer, J. T., Cromley, D. A., and Kempner, E. S. (1990) J. Biol. Chem. 265, 8632-8635[Abstract/Free Full Text]
  37. Erickson, S. K., Lear, S. R., and McCreery, M. J. (1994) J. Lipid Res. 35, 763-769[Abstract]
  38. Guo, Z., Yang, H., and Sturley, S. L. (1996) Circulation 94, I-35
  39. Rost, B. (1996) Methods Enzymol. 266, 525-539[CrossRef][Medline] [Order article via Infotrieve]
  40. Doolittle, G. M., and Chang, T. Y. (1982) Biochemistry 21, 674-679[CrossRef][Medline] [Order article via Infotrieve]
  41. Goodman, D. S., Deykin, D., and Shiratori, T. (1964) J. Biol. Chem. 239, 1335-1344[Free Full Text]
  42. Schoonderwoerd, K., Broekhoven-Schokker, S., Hulsmann, W. C., and Stam, H. (1990) Biochem. J. 268, 487-492[Medline] [Order article via Infotrieve]
  43. Einarsson, K., Benthin, L., Ewerth, S., Hellers, G., Stahlberg, D., and Angelin, B. (1989) J. Lipid Res. 30, 739-746[Abstract]
  44. Billheimer, J. T., and Gillies, P. J. (1992) in Advances in Cholesterol Research (Esfahani, M., and Swaney, J. B., eds), Telford Press, Philadelphia
  45. Wilson, J. E. (1995) Rev. Physiol. Biochem. Pharmacol. 126, 65-198[Medline] [Order article via Infotrieve]


Copyright © 1998 by The American Society for Biochemistry and Molecular Biology, Inc.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Am. J. Physiol. Endocrinol. Metab.Home page
T.-Y. Chang, B.-L. Li, C. C. Y. Chang, and Y. Urano
Acyl-coenzyme A:cholesterol acyltransferases
Am J Physiol Endocrinol Metab, July 1, 2009; 297(1): E1 - E9.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Endocrinol. Metab.Home page
A. R. Turkish and S. L. Sturley
The genetics of neutral lipid biosynthesis: an evolutionary perspective
Am J Physiol Endocrinol Metab, July 1, 2009; 297(1): E19 - E27.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Endocrinol. Metab.Home page
Y. Shi and D. Cheng
Beyond triglyceride synthesis: the dynamic functional roles of MGAT and DGAT enzymes in energy metabolism
Am J Physiol Endocrinol Metab, July 1, 2009; 297(1): E10 - E18.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
L. Lei, Y. Xiong, J. Chen, J.-B. Yang, Y. Wang, X.-Y. Yang, C. C. Y. Chang, B.-L. Song, T.-Y. Chang, and B.-L. Li
TNF-alpha stimulates the ACAT1 expression in differentiating monocytes to promote the CE-laden cell formation
J. Lipid Res., June 1, 2009; 50(6): 1057 - 1067.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Endocrinol. Metab.Home page
J. Iqbal and M. M. Hussain
Intestinal lipid absorption
Am J Physiol Endocrinol Metab, June 1, 2009; 296(6): E1183 - E1194.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
C.-L. E. Yen, S. J. Stone, S. Koliwad, C. Harris, and R. V. Farese Jr.
Thematic Review Series: Glycerolipids. DGAT enzymes and triacylglycerol biosynthesis
J. Lipid Res., November 1, 2008; 49(11): 2283 - 2301.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. A. Gijon, W. R. Riekhof, S. Zarini, R. C. Murphy, and D. R. Voelker
Lysophospholipid Acyltransferases and Arachidonate Recycling in Human Neutrophils
J. Biol. Chem., October 31, 2008; 283(44): 30235 - 30245.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J. Iqbal, L. L. Rudel, and M. M. Hussain
Microsomal Triglyceride Transfer Protein Enhances Cellular Cholesteryl Esterification by Relieving Product Inhibition
J. Biol. Chem., July 18, 2008; 283(29): 19967 - 19980.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
Y. Fujiwara, N. Kiyota, M. Hori, S. Matsushita, Y. Iijima, K. Aoki, D. Shibata, M. Takeya, T. Ikeda, T. Nohara, et al.
Esculeogenin A, a New Tomato Sapogenol, Ameliorates Hyperlipidemia and Atherosclerosis in ApoE-Deficient Mice by Inhibiting ACAT
Arterioscler. Thromb. Vasc. Biol., November 1, 2007; 27(11): 2400 - 2406.
[Abstract] [Full Text] [PDF]


Home page
Plant Physiol.Home page
Q. Chen, L. Steinhauer, J. Hammerlindl, W. Keller, and J. Zou
Biosynthesis of Phytosterol Esters: Identification of a Sterol O-Acyltransferase in Arabidopsis
Plant Physiology, November 1, 2007; 145(3): 974 - 984.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
T. A. Bell III, M. D. Wilson, K. Kelley, J. K. Sawyer, and L. L. Rudel
Monounsaturated fatty acyl-coenzyme A is predictive of atherosclerosis in human apoB-100 transgenic, LDLr-/- mice
J. Lipid Res., May 1, 2007; 48(5): 1122 - 1131.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Gastrointest. Liver Physiol.Home page
A. Turkish and S. L. Sturley
Regulation of Triglyceride Metabolism. I. Eukaryotic neutral lipid synthesis: "Many ways to skin ACAT or a DGAT"
Am J Physiol Gastrointest Liver Physiol, April 1, 2007; 292(4): G953 - G957.
[Abstract] [Full Text] [PDF]


Home page
Plant CellHome page
J. M. Shockey, S. K. Gidda, D. C. Chapital, J.-C. Kuan, P. K. Dhanoa, J. M. Bland, S. J. Rothstein, R. T. Mullen, and J. M. Dyer
Tung Tree DGAT1 and DGAT2 Have Nonredundant Functions in Triacylglycerol Biosynthesis and Are Localized to Different Subdomains of the Endoplasmic Reticulum
PLANT CELL, September 1, 2006; 18(9): 2294 - 2313.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
R. V. Farese Jr
The nine lives of ACAT inhibitors.
Arterioscler. Thromb. Vasc. Biol., August 1, 2006; 26(8): 1684 - 1686.
[Full Text] [PDF]


Home page
DiabetesHome page
N. Chen, L. Liu, Y. Zhang, H. N. Ginsberg, and Y.-H. Yu
Whole-body Insulin Resistance in the Absence of Obesity in FVB Mice With Overexpression of Dgat1 in Adipose Tissue
Diabetes, December 1, 2005; 54(12): 3379 - 3386.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
C.-L. E. Yen, M. Monetti, B. J. Burri, and R. V. Farese Jr.
The triacylglycerol synthesis enzyme DGAT1 also catalyzes the synthesis of diacylglycerols, waxes, and retinyl esters
J. Lipid Res., July 1, 2005; 46(7): 1502 - 1511.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. Yamazaki, E. Sasaki, C. Kakinuma, T. Yano, S. Miura, and O. Ezaki
Increased Very Low Density Lipoprotein Secretion and Gonadal Fat Mass in Mice Overexpressing Liver DGAT1
J. Biol. Chem., June 3, 2005; 280(22): 21506 - 21514.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
L. L. Rudel, R. G. Lee, and P. Parini
ACAT2 Is a Target for Treatment of Coronary Heart Disease Associated With Hypercholesterolemia
Arterioscler. Thromb. Vasc. Biol., June 1, 2005; 25(6): 1112 - 1118.
[Abstract] [Full Text] [PDF]


Home page
CirculationHome page
Y. R. Su, D. E. Dove, A. S. Major, A. H. Hasty, B. Boone, M. F. Linton, and S. Fazio
Reduced ABCA1-Mediated Cholesterol Efflux and Accelerated Atherosclerosis in Apolipoprotein E-Deficient Mice Lacking Macrophage-Derived ACAT1
Circulation, May 10, 2005; 111(18): 2373 - 2381.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. R. Turkish, A. L. Henneberry, D. Cromley, M. Padamsee, P. Oelkers, H. Bazzi, A. M. Christiano, J. T. Billheimer, and S. L. Sturley
Identification of Two Novel Human Acyl-CoA Wax Alcohol Acyltransferases: MEMBERS OF THE DIACYLGLYCEROL ACYLTRANSFERASE 2 (DGAT2) GENE SUPERFAMILY
J. Biol. Chem., April 15, 2005; 280(15): 14755 - 14764.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
H. C. Chen and R. V. Farese Jr
Inhibition of Triglyceride Synthesis as a Treatment Strategy for Obesity: Lessons From DGAT1-Deficient Mice
Arterioscler. Thromb. Vasc. Biol., March 1, 2005; 25(3): 482 - 486.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Renal Physiol.Home page
K. Liang, C. H. Kim, and N. D. Vaziri
HMG-CoA reductase inhibition reverses LCAT and LDL receptor deficiencies and improves HDL in rats with chronic renal failure
Am J Physiol Renal Physiol, March 1, 2005; 288(3): F539 - F544.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
J. X. Rong, J. Kusunoki, P. Oelkers, S. L. Sturley, and E. A. Fisher
Acyl-CoenzymeA (CoA):Cholesterol Acyltransferase Inhibition in Rat and Human Aortic Smooth Muscle Cells Is Nontoxic and Retards Foam Cell Formation
Arterioscler. Thromb. Vasc. Biol., January 1, 2005; 25(1): 122 - 127.
[Abstract] [Full Text] [PDF]


Home page
J. Nutr.Home page
J.-Y. Lee and T. P. Carr
Dietary Fatty Acids Regulate Acyl-CoA:Cholesterol Acyltransferase and Cytosolic Cholesteryl Ester Hydrolase in Hamsters
J. Nutr., December 1, 2004; 134(12): 3239 - 3244.
[Abstract] [Full Text] [PDF]


Home page
Circ. Res.Home page
R. G. Lee, K. L. Kelley, J. K. Sawyer, R. V. Farese Jr, J. S. Parks, and L. L. Rudel
Plasma Cholesteryl Esters Provided by Lecithin:Cholesterol Acyltransferase and Acyl-Coenzyme A:Cholesterol Acyltransferase 2 Have Opposite Atherosclerotic Potential
Circ. Res., November 12, 2004; 95(10): 998 - 1004.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Renal Physiol.Home page
N. D. Vaziri and K. Liang
ACAT inhibition reverses LCAT deficiency and improves plasma HDL in chronic renal failure
Am J Physiol Renal Physiol, November 1, 2004; 287(5): F1038 - F1043.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. Yang, O. Lee, J. Chen, J. Chen, C. C. Y. Chang, P. Zhou, Z.-Z. Wang, H.-H. Ma, H.-F. Sha, J.-X. Feng, et al.
Human Acyl-Coenzyme A:Cholesterol Acyltransferase 1 (acat1) Sequences Located in Two Different Chromosomes (7 and 1) Are Required to Produce a Novel ACAT1 Isoenzyme with Additional Sequence at the N Terminus
J. Biol. Chem., October 29, 2004; 279(44): 46253 - 46262.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J. J. Liang, P. Oelkers, C. Guo, P.-C. Chu, J. L. Dixon, H. N. Ginsberg, and S. L. Sturley
Overexpression of Human Diacylglycerol Acyltransferase 1, Acyl-CoA:Cholesterol Acyltransferase 1, or Acyl-CoA:Cholesterol Acyltransferase 2 Stimulates Secretion of Apolipoprotein B-containing Lipoproteins in McA-RH7777 Cells
J. Biol. Chem., October 22, 2004; 279(43): 44938 - 44944.
[Abstract] [Full Text] [PDF]


Home page
CirculationHome page
P. Parini, M. Davis, A. T. Lada, S. K. Erickson, T. L. Wright, U. Gustafsson, S. Sahlin, C. Einarsson, M. Eriksson, B. Angelin, et al.
ACAT2 Is Localized to Hepatocytes and Is the Major Cholesterol-Esterifying Enzyme in Human Liver
Circulation, October 5, 2004; 110(14): 2017 - 2023.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
S. H. Ganji, S. Tavintharan, D. Zhu, Y. Xing, V. S. Kamanna, and M. L. Kashyap
Niacin noncompetitively inhibits DGAT2 but not DGAT1 activity in HepG2 cells
J. Lipid Res., October 1, 2004; 45(10): 1835 - 1845.
[Abstract] [Full Text] [PDF]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
M. Hori, M. Satoh, K. Furukawa, Y.-i. Sakamoto, H. Hakamata, Y. Komohara, M. Takeya, Y. Sasaki, A. Miyazaki, and S. Horiuchi
Acyl-Coenzyme A:Cholesterol Acyltransferase-2 (ACAT-2) Is Responsible for Elevated Intestinal ACAT Activity in Diabetic Rats
Arterioscler. Thromb. Vasc. Biol., September 1, 2004; 24(9): 1689 - 1695.
[Abstract] [Full Text] [PDF]


Home page
CirculationHome page
N.D. Vaziri and K.H. Liang
Acyl-Coenzyme A:Cholesterol Acyltransferase Inhibition Ameliorates Proteinuria, Hyperlipidemia, Lecithin-Cholesterol Acyltransferase, SRB-1, and Low-Denisty Lipoprotein Receptor Deficiencies in Nephrotic Syndrome
Circulation, July 27, 2004; 110(4): 419 - 425.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
J. L. Smith, K. Rangaraj, R. Simpson, D. J. Maclean, L. K. Nathanson, K. A. Stuart, S. P. Scott, G. A. Ramm, and J. de Jersey
Quantitative analysis of the expression of ACAT genes in human tissues by real-time PCR2
J. Lipid Res., April 1, 2004; 45(4): 686 - 696.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
N. M. Q. Palacpac, Y. Hiramine, F. Mi-ichi, M. Torii, K. Kita, R. Hiramatsu, T. Horii, and T. Mitamura
Developmental-stage-specific triacylglycerol biosynthesis, degradation and trafficking as lipid bodies in Plasmodium falciparum-infected erythrocytes
J. Cell Sci., March 15, 2004; 117(8): 1469 - 1480.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
A. T. Lada, M. Davis, C. Kent, J. Chapman, H. Tomoda, S. Omura, and L. L. Rudel
Identification of ACAT1- and ACAT2-specific inhibitors using a novel, cell-based fluorescence assay: individual ACAT uniqueness
J. Lipid Res., February 1, 2004; 45(2): 378 - 386.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
I. Namatame, H. Tomoda, S. Ishibashi, and S. Omura
Antiatherogenic activity of fungal beauveriolides, inhibitors of lipid droplet accumulation in macrophages
PNAS, January 20, 2004; 101(3): 737 - 742.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Q. Zhang, H. K. Chieu, C. P. Low, S. Zhang, C. K. Heng, and H. Yang
Schizosaccharomyces pombe Cells Deficient in Triacylglycerols Synthesis Undergo Apoptosis upon Entry into the Stationary Phase
J. Biol. Chem., November 21, 2003; 278(47): 47145 - 47155.
[Abstract] [Full Text] [PDF]


Home page
Physiol. GenomicsHome page
B. Schmitt, M. Fluck, J. Decombaz, R. Kreis, C. Boesch, M. Wittwer, F. Graber, M. Vogt, H. Howald, and H. Hoppeler
Transcriptional adaptations of lipid metabolism in tibialis anterior muscle of endurance-trained athletes
Physiol Genomics, October 17, 2003; 15(2): 148 - 157.
[Abstract] [Full Text] [PDF]


Home page
Eukaryot CellHome page
P. Nawabi, A. Lykidis, D. Ji, and K. Haldar
Neutral-Lipid Analysis Reveals Elevation of Acylglycerols and Lack of Cholesterol Esters in Plasmodium falciparum-Infected Erythrocytes
Eukaryot. Cell, October 1, 2003; 2(5): 1128 - 1131.
[Abstract] [Full Text] [PDF]


Home page
Mol. Biol. CellHome page
S. Lin, X. Lu, C. C.Y. Chang, and T.-Y. Chang
Human Acyl-Coenzyme A:Cholesterol Acyltransferase Expressed in Chinese Hamster Ovary Cells: Membrane Topology and Active Site Location
Mol. Biol. Cell, June 1, 2003; 14(6): 2447 - 2460.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
E. L. Willner, B. Tow, K. K. Buhman, M. Wilson, D. A. Sanan, L. L. Rudel, and R. V. Farese Jr.
Deficiency of acyl CoA:cholesterol acyltransferase 2 prevents atherosclerosis in apolipoprotein E-deficient mice
PNAS, February 4, 2003; 100(3): 1262 - 1267.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
H. Chao, M. Zhou, A. McIntosh, F. Schroeder, and A. B. Kier
ACBP and cholesterol differentially alter fatty acyl CoA utilization by microsomal ACAT
J. Lipid Res., January 1, 2003; 44(1): 72 - 83.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Y.-H. Yu, Y. Zhang, P. Oelkers, S. L. Sturley, D. J. Rader, and H. N. Ginsberg
Posttranscriptional Control of the Expression and Function of Diacylglycerol Acyltransferase-1 in Mouse Adipocytes
J. Biol. Chem., December 20, 2002; 277(52): 50876 - 50884.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Physiol. Endocrinol. Metab.Home page
K. Liang and N. D. Vaziri
Upregulation of acyl-CoA:cholesterol acyltransferase in chronic renal failure
Am J Physiol Endocrinol Metab, October 1, 2002; 283(4): E676 - E681.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
C. Xie, L. A. Woollett, S. D. Turley, and J. M. Dietschy
Fatty acids differentially regulate hepatic cholesteryl ester formation and incorporation into lipoproteins in the liver of the mouse
J. Lipid Res., September 1, 2002; 43(9): 1508 - 1519.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
N. M. Borradaile, L. E. de Dreu, P. H. R. Barrett, and M. W. Huff
Inhibition of hepatocyte apoB secretion by naringenin: enhanced rapid intracellular degradation independent of reduced microsomal cholesteryl esters
J. Lipid Res., September 1, 2002; 43(9): 1544 - 1554.
[Abstract] [Full Text] [PDF]


Home page
GeneticsHome page
M. Buszczak, X. Lu, W. A. Segraves, T. Y. Chang, and L. Cooley
Mutations in the midway Gene Disrupt a Drosophila Acyl Coenzyme A: Diacylglycerol Acyltransferase
Genetics, April 1, 2002; 160(4): 1511 - 1518.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Oelkers, D. Cromley, M. Padamsee, J. T. Billheimer, and S. L. Sturley
The DGA1 Gene Determines a Second Triglyceride Synthetic Pathway in Yeast
J. Biol. Chem., March 8, 2002; 277(11): 8877 - 8881.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
T. Y. Chang, C. C. Y. Chang, X. Lu, and S. Lin
Catalysis of ACAT may be completed within the plane of the membrane: a working hypothesis
J. Lipid Res., December 1, 2001; 42(12): 1933 - 1938.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Cases, S. J. Stone, P. Zhou, E. Yen, B. Tow, K. D. Lardizabal, T. Voelker, and R. V. Farese Jr.
Cloning of DGAT2, a Second Mammalian Diacylglycerol Acyltransferase, and Related Family Members
J. Biol. Chem., October 12, 2001; 276(42): 38870 - 38876.
[Abstract] [Full Text] [PDF]


Home page
J. Bacteriol.Home page
K. Jensen-Pergakes, Z. Guo, M. Giattina, S. L. Sturley, and M. Bard
Transcriptional Regulation of the Two Sterol Esterification Genes in the Yeast Saccharomyces cerevisiae
J. Bacteriol., September 1, 2001; 183(17): 4950 - 4957.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
Z. Guo, D. Cromley, J. T. Billheimer, and S. L. Sturley
Identification of potential substrate-binding sites in yeast and human acyl-CoA sterol acyltransferases by mutagenesis of conserved sequences
J. Lipid Res., August 1, 2001; 42(8): 1282 - 1291.
[Abstract] [Full Text] [PDF]


Home page
Plant Physiol.Home page
C. Jako, A. Kumar, Y. Wei, J. Zou, D. L. Barton, E. M. Giblin, P. S. Covello, and D. C. Taylor
Seed-Specific Over-Expression of an Arabidopsis cDNA Encoding a Diacylglycerol Acyltransferase Enhances Seed Oil Content and Seed Weight
Plant Physiology, June 1, 2001; 126(2): 861 - 874.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
L. J. Wilcox, N. M. Borradaile, L. E. de Dreu, and M. W. Huff
Secretion of hepatocyte apoB is inhibited by the flavonoids, naringenin and hesperetin, via reduced activity and expression of ACAT2 and MTP
J. Lipid Res., May 1, 2001; 42(5): 725 - 734.
[Abstract] [Full Text]


Home page
J. Lipid Res.Home page
K. Aragane, K. Fujinami, K. Kojima, and J. Kusunoki
ACAT inhibitor F-1394 prevents intimal hyperplasia induced by balloon injury in rabbits
J. Lipid Res., April 1, 2001; 42(4): 480 - 488.
[Abstract] [Full Text]


Home page
J. Lipid Res.Home page
K. K. Maung, A. Miyazaki, H. Nomiyama, C. C. Y. Chang, T.-Y. Chang, and S. Horiuchi
Induction of acyl-coenzyme A:cholesterol acyltransferase-1 by 1,25-dihydroxyvitamin D3 or 9-cis-retinoic acid in undifferentiated THP-1 cells
J. Lipid Res., February 1, 2001; 42(2): 181 - 187.
[Abstract] [Full Text]


Home page
IOVSHome page
A. Ruiz, M. H. Kuehn, J. L. Andorf, E. Stone, G. S. Hageman, and D. Bok
Genomic Organization and Mutation Analysis of the Gene Encoding Lecithin Retinol Acyltransferase in Human Retinal Pigment Epithelium
Invest. Ophthalmol. Vis. Sci., January 1, 2001; 42(1): 31 - 37.
[Abstract] [Full Text]


Home page
J. Lipid Res.Home page
R. G. Lee, M. C. Willingham, M. A. Davis, K. A. Skinner, and L. L. Rudel
Differential expression of ACAT1 and ACAT2 among cells within liver, intestine, kidney, and adrenal of nonhuman primates
J. Lipid Res., December 1, 2000; 41(12): 1991 - 2001.
[Abstract] [Full Text]


Home page
Mol. Biol. CellHome page
C. W. Joyce, G. S. Shelness, M. A. Davis, R. G. Lee, K. Skinner, R. A. Anderson, and L. L. Rudel
ACAT1 and ACAT2 Membrane Topology Segregates a Serine Residue Essential for Activity to Opposite Sides of the Endoplasmic Reticulum Membrane
Mol. Biol. Cell, November 1, 2000; 11(11): 3675 - 3687.
[Abstract] [Full Text]


Home page
J. Pharmacol. Exp. Ther.Home page
N. N. Izzat, M. E. Deshazer, and D. S. Loose-Mitchell
New Molecular Targets for Cholesterol-Lowering Therapy
J. Pharmacol. Exp. Ther., May 1, 2000; 293(2): 315 - 320.
[Abstract] [Full Text]


Home page
Arterioscler. Thromb. Vasc. Bio.Home page
J. Kusunoki, K. Aragane, T. Kitamine, H. Kozono, K. Kano, K. Fujinami, K. Kojima, T. Chiwata, and Y. Sekine
Postprandial Hyperlipidemia in Streptozotocin-Induced Diabetic Rats Is Due to Abnormal Increase in Intestinal Acyl Coenzyme A:Cholesterol Acyltransferase Activity
Arterioscler. Thromb. Vasc. Biol., January 1, 2000; 20(1): 171 - 178.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Pathol.Home page
N. Sakashita, A. Miyazaki, M. Takeya, S. Horiuchi, C. C. Y. Chang, T.-Y. Chang, and K. Takahashi
Localization of Human Acyl-Coenzyme A:Cholesterol Acyltransferase-1 (ACAT-1) in Macrophages and in Various Tissues
Am. J. Pathol., January 1, 2000; 156(1): 227 - 236.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Yu, J. Chen, S. Lin, J. Liu, C. C. Y. Chang, and T.-Y. Chang
Human Acyl-CoA:Cholesterol Acyltransferase-1 Is a Homotetrameric Enzyme in Intact Cells and in Vitro
J. Biol. Chem., December 17, 1999; 274(51): 36139 - 36145.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
K. A. H. Abo-Hashema, M. H. Cake, G. W. Power, and D. Clarke
Evidence for Triacylglycerol Synthesis in the Lumen of Microsomes via a Lipolysis-Esterification Pathway Involving Carnitine Acyltransferases
J. Biol. Chem., December 10, 1999; 274(50): 35577 - 35582.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Lin, D. Cheng, M.-S. Liu, J. Chen, and T.-Y. Chang
Human Acyl-CoA:Cholesterol Acyltransferase-1 in the Endoplasmic Reticulum Contains Seven Transmembrane Domains
J. Biol. Chem., August 13, 1999; 274(33): 23276 - 23285.
[Abstract] [Full Text] [PDF]


Home page
J. Lipid Res.Home page
J. R. Burnett, L. J. Wilcox, D. E. Telford, S. J. Kleinstiver, P. H. R. Barrett, R. S. Newton, and M. W. Huff
Inhibition of ACAT by avasimibe decreases both VLDL and LDL apolipoprotein B production in miniature pigs
J. Lipid Res., July 1, 1999; 40(7): 1317 - 1328.
[Abstract] [Full Text]


Home page
J. Lipid Res.Home page
R. L. Hamilton, A. Moorehouse, S. R. Lear, J. S. Wong, and S. K. Erickson
A rapid calcium precipitation method of recovering large amounts of highly pure hepatocyte rough endoplasmic reticulum
J. Lipid Res., June 1, 1999; 40(6): 1140 - 1147.
[Abstract] [Full Text]


Home page
J. Biol. Chem.Home page
D. Warnecke, R. Erdmann, A. Fahl, B. Hube, F. Muller, T. Zank, U. Zahringer, and E. Heinz
Cloning and Functional Expression of UGT Genes Encoding Sterol Glucosyltransferases from Saccharomyces cerevisiae, Candida albicans, Pichia pastoris, and Dictyostelium discoideum
J. Biol. Chem., May 7, 1999; 274(19): 13048 - 13059.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
B.-L. Li, X.-L. Li, Z.-J. Duan, O. Lee, S. Lin, Z.-M. Ma, C. C. Y. Chang, X.-Y. Yang, J. P. Park, T. K. Mohandas, et al.
Human Acyl-CoA:Cholesterol Acyltransferase-1 (ACAT-1) Gene Organization and Evidence That the 4.3-Kilobase ACAT-1 mRNA Is Produced from Two Different Chromosomes
J. Biol. Chem., April 16, 1999; 274(16): 11060 - 11071.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Cases, S. Novak, Y.-W. Zheng, H. M. Myers, S. R. Lear, E. Sande, C. B. Welch, A. J. Lusis, T. A. Spencer, B. R. Krause, et al.
ACAT-2, A Second Mammalian Acyl-CoA:Cholesterol Acyltransferase. ITS CLONING, EXPRESSION, AND CHARACTERIZATION
J. Biol. Chem., October 9, 1998; 273(41): 26755 - 26764.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
P. Oelkers, A. Tinkelenberg, N. Erdeniz, D. Cromley, J. T. Billheimer, and S. L. Sturley
A Lecithin Cholesterol Acyltransferase-like Gene Mediates Diacylglycerol Esterification in Yeast
J. Biol. Chem., May 19, 2000; 275(21): 15609 - 15612.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
H. Yagyu, T. Kitamine, J.-i. Osuga, R.-i. Tozawa, Z. Chen, Y. Kaji, T. Oka, S. Perrey, Y. Tamura, K. Ohashi, et al.
Absence of ACAT-1 Attenuates Atherosclerosis but Causes Dry Eye and Cutaneous Xanthomatosis in Mice with Congenital Hyperlipidemia
J. Biol. Chem., July 7, 2000; 275(28): 21324 - 21330.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. C. Y. Chang, N. Sakashita, K. Ornvold, O. Lee, E. T. Chang, R. Dong, S. Lin, C.-Y. G. Lee, S. C. Strom, R. Kashyap, et al.
Immunological Quantitation and Localization of ACAT-1 and ACAT-2 in Human Liver and Small Intestine
J. Biol. Chem., September 1, 2000; 275(36): 28083 - 28092.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J.-B. Yang, Z.-J. Duan, W. Yao, O. Lee, L. Yang, X.-Y. Yang, X. Sun, C. C. Y. Chang, T.-Y. Chang, and B.-L. Li
Synergistic Transcriptional Activation of Human Acyl-coenzyme A: Cholesterol Acyltransterase-1 Gene by Interferon-gamma and All-trans-Retinoic Acid THP-1 Cells
J. Biol. Chem., June 8, 2001; 276(24): 20989 - 20998.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
K. K. Buhman, H. C. Chen, and R. V. Farese Jr.
The Enzymes of Neutral Lipid Synthesis
J. Biol. Chem., October 26, 2001; 276(44): 40369 - 40372.
[Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Oelkers, P.
Right arrow Articles by Sturley, S. L.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Oelkers, P.
Right arrow Articles by Sturley, S. L.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 1998 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement