JBC Avanti Polar Lipids

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zeng, W.
Right arrow Articles by Wilkie, T. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zeng, W.
Right arrow Articles by Wilkie, T. M.

J Biol Chem, Vol. 273, Issue 52, 34687-34690, December 25, 1998

COMMUNICATION
The N-terminal Domain of RGS4 Confers Receptor-selective Inhibition of G Protein Signaling*

Weizhang ZengDagger §, Xin XuDagger §, Serguei Popov§, Suchetana Mukhopadhyay, Peter Chidiac, Joseph Swistokparallel , Waleed Danhoparallel , Keith A. Yagaloffparallel , Stewart L. Fisherparallel , Elliott M. Ross, Shmuel MuallemDagger , and Thomas M. Wilkie**

From the Departments of Dagger  Physiology and  Pharmacology, University of Texas Southwestern Medical Center, Dallas, Texas 75235 and parallel  Department of Metabolic Diseases, Hoffmann-La Roche, Inc., Nutley, New Jersey 07110

    ABSTRACT
Top
Abstract
Introduction
Materials & Methods
Results & Discussion
References

Regulators of heterotrimeric G protein signaling (RGS) proteins are GTPase-activating proteins (GAPs) that accelerate GTP hydrolysis by Gq and Gi alpha  subunits, thus attenuating signaling. Mechanisms that provide more precise regulatory specificity have been elusive. We report here that an N-terminal domain of RGS4 discriminated among receptor signaling complexes coupled via Gq. Accordingly, deletion of the N-terminal domain of RGS4 eliminated receptor selectivity and reduced potency by 104-fold. Receptor selectivity and potency of inhibition were partially restored when the RGS4 box was added together with an N-terminal peptide. In vitro reconstitution experiments also indicated that sequences flanking the RGS4 box were essential for high potency GAP activity. Thus, RGS4 regulates Gq class signaling by the combined action of two domains: 1) the RGS box accelerates GTP hydrolysis by Galpha q and 2) the N terminus conveys high affinity and receptor-selective inhibition. These activities are each required for receptor selectivity and high potency inhibition of receptor-coupled Gq signaling.

    INTRODUCTION
Top
Abstract
Introduction
Materials & Methods
Results & Discussion
References

Heterotrimeric G proteins of the Gq class are mediators of Ca2+ responses in animal cells. Signaling is initiated by agonist binding to heptahelical transmembrane receptors complexed with Gqalpha beta gamma and phospholipase C-beta (PLCbeta )1 (1), which generates IP3 to trigger Ca2+ release from internal stores (2). Many cells express several Gq-coupled receptors that regulate the location, intensity, and propagation of intracellular Ca2+ waves. For example, pancreatic acini respond to acetylcholine, bombesin, and cholecystokinin by activating the same set of Gq class proteins and mobilizing the same Ca2+ pool, but each receptor evokes distinct patterns of Ca2+ waves (3). Ca2+ release may be regulated by intracellular proteins that interact with guanine nucleotide binding proteins, such as regulators of G protein signaling (RGS) proteins.2

RGS proteins are GTPase-activating proteins (GAPs) that accelerate GTP hydrolysis by Gq and Gi alpha  subunits, thus attenuating signaling (5-8). Mammals express over 20 different RGS proteins, of which RGS4 has received the most extensive biochemical characterization (5, 7-12). RGS4 is composed of a central domain of 120 amino acids that is homologous to other RGS proteins, termed the RGS box, flanked by less well conserved N- and C-terminal sequences (13). In rat pancreatic acinar cells, RGS4 preferentially inhibited Gq/11-mediated signaling evoked by carbachol relative to bombesin and cholecystokinin regardless of the identity of the Gq class alpha  subunit.2 Regulatory specificity was apparently conferred by direct or indirect interaction between RGS4 and the receptor.

In the present study, we used deletion mutations to identify two domains in RGS4 that regulate agonist-dependent Ca2+ signaling. The RGS box accelerates GTP hydrolysis by Galpha q whereas the N terminus conveys high affinity and receptor-selective inhibition. These combined activities are required for receptor selectivity and high potency inhibition of receptor-coupled Gq signaling.

    MATERIALS AND METHODS
Top
Abstract
Introduction
Materials & Methods
Results & Discussion
References

Expression and Purification of Recombinant RGS4 Proteins-- All recombinant RGS proteins were His6-tagged at the N terminus. Protein expression and GAP assays were performed as described (10).

Peptide Synthesis-- Synthetic peptides3 were purified by reverse-phase high pressure liquid chromatography and confirmed by amino acid analysis and fast atom bombardment/mass spectroscopy.

Measurement of Ca2+ Release-- Measurement of Ca2+-activated Cl- current and Ca2+ release in permeabilized cells was exactly as described.2

GTPase Measurements-- The agonist-stimulated steady-state GTPase activity of reconstituted phospholipid vesicles that contained m1 muscarinic acetylcholine receptors and heterotrimeric Gq was assayed in the presence or absence of RGS proteins or peptides as described (14). Single-turnover measurements of the hydrolysis of Galpha q-GTP were performed as described (15) using [gamma -32P]GTP bound to the R183C mutant of Galpha q (chosen to slow hydrolysis and thus facilitate loading).

    RESULTS AND DISCUSSION
Top
Abstract
Introduction
Materials & Methods
Results & Discussion
References

The N Terminus of RGS4 Is Required for High Potency Inhibition-- To determine the domains of RGS4 that conveyed high potency and receptor-selective inhibition, rat pancreatic acinar cells were dialyzed with different recombinant RGS4 proteins through a patch pipette and exposed to 100 µM carbachol, the minimal concentration of carbachol needed to generate a maximal cellular response (16, 17).2 Responses were detected as changes in current carried by a Ca2+-activated Cl- channel. In the control (Fig. 1a), carbachol evoked a typical biphasic Ca2+ response consisting of an initial spike caused by Ca2+ release from internal stores followed by a plateau current. Infusion of full-length RGS4 (10 pM) suppressed the initial Ca2+ release and caused subsequent oscillations in response to maximal carbachol stimulation. Increasing the RGS4 concentration to 100 pM further reduced the Ca2+ response to a low frequency oscillation. A similar transition from a sustained to a weak oscillatory response occurred when the carbachol concentration was reduced from 100 to 1 µM (16, 17).2 This indicates that carbachol-evoked signaling in intact cells dialyzed with 100 pM RGS4 is functionally equivalent to a 100-fold decrease in the potency of carbachol stimulation. Exposing cells to higher concentrations of carbachol did not change the inhibitory effect of RGS4 on Ca2+ release. Two other proteins related to RGS4, RGS1, and RGS16 (13, 18, 19) also inhibit carbachol-evoked Ca2+ release, but RGS10, a GAP for the Gi class (6, 10), has no effect on Gq-mediated signaling (data not shown).


View larger version (25K):
[in this window]
[in a new window]
 
Fig. 1.   Deletion of the RGS4 N terminus destroys high potency inhibition of Ca2+ release. Cells were dialyzed for at least 7 min with the pipette solution before the first stimulation. a, standard response to carbachol (Car). Inhibition of Ca2+ signaling by recombinant proteins was assayed with: b and c, RGS4; d-f, 4Box, 58-177; g and h, RGS4Delta C, 1-177; i and j, RGS4Delta N, 58-205. Data for RGS4 and 4Box are representative of at least 20 experiments each (RGS4Delta N, n >=  6; RGS4Delta C, n = 3).

We next tested the effect of the RGS domain of RGS4 (4Box) (Fig. 1, d-f). Although full-length RGS4 and 4Box accelerated GTP hydrolysis by purified Galpha i1 with equal potency in vitro (10), 4Box was approximately 104-fold less potent than full-length RGS4 in inhibiting in vivo Ca2+ signaling. For example, 10 pM RGS4 conferred partial inhibition of signaling whereas 100 nM 4Box was required before partial inhibition was apparent (Fig. 1, b and d). Increasing the cellular concentration of full-length RGS4 gradually inhibited signaling, decreasing both the amplitude of the initial current spike and the frequency and amplitude of the subsequent current oscillations (Fig. 1, a-c). By contrast, dialysis with as much as 100 nM 4Box did not significantly reduce the initial current spike but caused rapid termination of signaling and obliterated subsequent oscillations in the continued presence of agonist (Fig. 1d). These data also indicated that the mechanisms of inhibition by RGS4 and 4Box were qualitatively different, suggesting that inhibition by intact RGS4 involves more than just Gq GAP activity.

To identify the flanking structure in full-length RGS4 that conveys high potency inhibition, we tested the activities of other deletion mutants. C-terminal truncation of RGS4 (RGS4Delta C) reduced its potency by about 100-fold (Fig. 1, g and h). For example, 10 nM RGS4Delta C inhibited the initial current spike to the same extent as did 100 pM full-length RGS4 and caused similar subsequent oscillations in response to 100 µM carbachol (compare Fig. 1, c and h). This effect was not further characterized because deletion of the N-terminal sequence flanking the RGS box (RGS4Delta N) caused an even more dramatic reduction in potency and altered the mechanism of RGS4 inhibition to resemble that observed with 4Box (Fig. 1, i and j). Hence, the N terminus of RGS4 is essential for high potency inhibition and contributes significantly to RGS4 interaction with the receptor-Gq protein complex.

Besides diminishing the effect and potency of RGS4 action, 4Box also lost selectivity among different receptors. RGS4 inhibits signaling preferentially through the m3 muscarinic receptor compared with the CCK receptor, assayed either separately or sequentially within the same cell (Fig. 2).2 By contrast, 4Box inhibited Ca2+ signaling by carbachol and CCK equivalently over a wide range of concentrations (Fig. 2, c-f). These data suggest that terminal regions of RGS4 both enhance potency and mediate recognition of receptor.


View larger version (24K):
[in this window]
[in a new window]
 
Fig. 2.   4Box is a non-selective inhibitor whereas P1-33 confers preferential inhibition of carbachol signaling. Cells were stimulated with 100 µM carbachol (Car), inhibited with 10 µM atropine (Atr), and then stimulated with 10 nM CCK8, as indicated. a, cell dialyzed with buffer.2 b, addition of 100 pM RGS4 showed that carbachol-dependent signaling was about 15 ± 3 (n = 17)-fold more sensitive to RGS4 than CCK-dependent signaling.2 4Box inhibited the response to carbachol and CCK equivalently: c, with 100 nM 4Box, the ratio of CCK to carbachol (CCK/Car) response was 0.98 ± 0.07 (n = 33); d, 300 nM 4Box, CCK/Car = 1.03 ± 0.16 (n = 3); e, 1 µM 4Box, CCK/Car = 0.93 ± 0.11 (n = 8); f, 10 µM 4Box, CCK/Car = 0.97 ± 0.15 (n = 5). g-i, P1-33 (100 nM, 300 nM, and 1 µM) preferentially inhibited the response to carbachol. Similar effects with increasing concentration of P1-33 were observed in three experiments with separate cell preparations.

Receptor-selective Inhibition by the RGS4 N-terminal Domain-- Next, we tested whether the 33-amino acid N-terminal peptide of RGS4 (P1-33) can itself alter Gq-mediated signaling. P1-33 (100 nM) both blocked the initial spike and converted the following sustained current to an oscillatory response (Fig. 2, g-i). Higher concentrations of P1-33 completely blocked signaling by carbachol. In contrast, these concentrations of P1-33 had no effect on CCK signaling. Only at 1 µM P1-33 was the sustained response evoked by CCK converted to an oscillatory current. These data indicate both that P1-33 effectively inhibited Gq-mediated Ca2+ signaling and that inhibition retained the selectivity for the m3 muscarinic receptor over the CCK receptor that is characteristic of RGS4.

RGS4 Flanking Sequences Enhance Galpha q-GAP Activity in Vitro-- We then tested the relative GAP activity of RGS4 and 4Box toward purified, recombinant Galpha q proteins in vitro. In a solution phase, single-turnover Galpha q GAP assay, RGS4 was about 10-fold more active than 4Box (Fig. 3, a and c), in contrast to their equal potency when assayed with Galpha i1 (10). We then compared the GAP activity of full-length RGS4 and 4Box on wild-type Gq in a steady-state, receptor-coupled in vitro assay. Phospholipid vesicles were reconstituted with m1 muscarinic cholinergic receptor and trimeric Gqalpha beta gamma , wherein steady-state GDP-GTP exchange on Galpha q was agonist-dependent (14). In this assay, RGS4 was about 125-fold more potent than 4Box in stimulating steady-state receptor-dependent GTPase activity (Fig. 3, b and c). Phospholipid vesicles reconstituted with m2 muscarinic cholinergic receptor and trimeric Galpha i1beta gamma revealed an even more pronounced difference between the relative activities of full-length RGS4 and 4Box (data not shown). These findings provide additional evidence that sequences flanking the RGS box are essential for optimal GAP activity in receptor-G protein-coupled signaling.


View larger version (26K):
[in this window]
[in a new window]
 
Fig. 3.   Activation of Galpha q GTPase by 4Box and RGS4. a, single hydrolytic turnover. Galpha qR183C-[gamma -32P]GTP was incubated in the presence or absence of RGS4 or 4Box for 30 s at 20 °C to approximate an initial rate. Data are the average of four determinations (±S.D.) and are representative of three independent experiments (full concentration range tested was 5-1000 nM). Basal hydrolysis was linear for up to 1 h, and this rate was used to calculate the control value. b, steady-state GTPase of Galpha q. m1 receptor and Gqalpha beta gamma were co-reconstituted into phospholipid vesicles as described (14). Steady-state GTPase activity was measured in the presence of either 1 mM carbachol (black bars) or 10 µM atropine (not shown; basal GTP hydrolysis was below 0.12 fmol/min/fmol of Galpha q). c, relative RGS4 and 4Box activities, shown as a ratio in the two assay conditions, were calculated from the data in a and b and additional experiments.

N Terminus and 4Box Act Synergistically to Inhibit Ca2+ Signaling-- The results in Figs. 1-3 clearly show that 4Box has Gq-GAP activity but that the N-terminal domain of RGS4 both conferred receptor selectivity upon RGS4 action and increased its potency in intact cells. To address the mechanism of RGS4 action, Ca2+ release from intracellular stores was measured in streptolysin O-permeabilized cells. These cells sequester Ca2+ from the incubation medium into cellular organelles and retain Gq-coupled signaling in response to all agonists that act on acinar cells (3, 20). This experimental approach facilitated addition of GTPgamma S to reverse inhibition by RGS4 as a test of its Gq GAP activity.

As shown in Fig. 4a, muscarinic stimulation released about 75-80% of the IP3-sensitive Ca2+ pool. Addition of 125 nM RGS4 inhibited more than 95% of the normal carbachol-stimulated Ca2+ release (Fig. 4f). Permeabilized cells were less sensitive to RGS4 than patch-clamped cells, probably because of a slower diffusion of proteins from the extracellular media into the cytosol. RGS4 inhibition was fully reversible by addition of GTPgamma S (Fig. 4f), suggesting that inhibition of signaling reflects the GAP activity of RGS4 under these conditions. By contrast, addition of up to 1.4 µM 4Box to the incubation medium had no effect on carbachol-stimulated Ca2+ release (Fig. 4b) further demonstrating that full-length RGS4 inhibits Gq-coupled signaling far more potently than does 4Box.


View larger version (31K):
[in this window]
[in a new window]
 
Fig. 4.   The RGS4 N-terminal peptide P1-33 and 4Box act synergistically to inhibit carbachol-stimulated release of intracellular Ca2+. Pancreatic acini were incubated in medium (a) or different concentrations of 4Box (b, h, i), P1-33 (c, d, e, g, h, i), and/or full-length RGS4 (f, g). Cells were stimulated with 2 mM carbachol and then treated sequentially with 2.5 µM GTPgamma S and 2 µM IP3 to test for their ability to activate Gq and to release stored Ca2+, respectively. Similar results were obtained in at least three additional experiments. In control experiments, the three Cys residues at positions 2, 12, and 33 of P1-33 were replaced with Ala (P1-33CA2,12,33), which reduced the effectiveness of the peptide by at least 100-fold (n = 6). The peptide P13-32 was 10-fold less effective than P1-33 (n = 3). Secondary structure analysis predicts P1-33 to have a hydrophobic N terminus (residues 1-10) followed by an amphipathic helix. In additional controls, the amphipathic peptide HT-31 (21) at 0.5 mM had no effect on agonist- or IP3-induced Ca2+ release. P1-33 (1 µM) did not accelerate GTP hydrolysis by Gq in the steady-state assay (Fig. 3), and P1-33 (200 µM) only marginally stimulated GTP hydrolysis by Galpha i1-bound GTP in the single-turnover assay (10).

Consistent with its effects in intact cells, P1-33 inhibited Ca2+ release in permeabilized cells in a receptor-selective manner (Fig. 4, c-e). Carbachol-evoked Ca2+ release was inhibited completely by 62 µM P1-33, with an IC50 of 25 ± 2 µM (n = 5). Similar measurements with CCK showed an IC50 for P1-33 of 62 ± 5 µM (n = 3). Thus, in permeabilized cells, P1-33 inhibited Ca2+ release evoked by carbachol 2.5-fold better than that evoked by CCK (Fig. 4e). Several control experiments further indicated that inhibition by P1-33 was specific. First, cells responded normally to addition of IP3, even in the presence of 62 µM P1-33 (Fig. 4, c and d). Second, HT-31, another amphipathic peptide that disrupts protein kinase A anchoring to AKAPs (21), had no effect on signaling in response to carbachol. Third, amino acid substitutions within P1-33 dramatically lowered its inhibitory activity (see legend to Fig. 4). Fourth, P1-33 preferentially inhibited signaling via the muscarinic receptor compared with the CCK receptor.

An important distinction between P1-33 and RGS4 is that the inhibitory effect of P1-33 was not reversed by GTPgamma S (Fig. 4, c and d), indicating that its effect does not depend on Gq-GAP activity. Sequential addition of P1-33 and RGS4 blocked GTPgamma S-insensitive inhibition (Fig. 4g), indicating the peptide and full-length RGS4 compete for binding to a subsite of the RGS4 binding site in the receptor-Gq complex. To further investigate P1-33 inhibition of Ca2+ release, we changed the order of addition of inhibitors and activators. If cells were exposed to P1-33, then carbachol, subsequent addition of either RGS4 or 4Box did not restore the ability of GTPgamma S to stimulate Ca2+ release (similar to Fig. 4d). RGS4 and 4Box only worked when added prior to carbachol stimulation (Fig. 4, f-h). P1-33 does not prevent receptor-catalyzed GTP exchange on Galpha q nor does P1-33 act as a Gq GAP (data not shown). This overall pattern of activities suggests that P1-33 binds at a site normally occupied by the N terminus of RGS4, and when added without 4Box, P1-33 blocks interaction of Gq with its effector protein PLCbeta .

A final and distinctive activity of P1-33 was that exposure to both 4Box and P1-33 inhibited Ca2+ release with greater potency than either added alone (compare Fig. 4, b, c, and h). Importantly, this inhibition was reversed by GTPgamma S, indicating that the GAP activity of 4Box was functional in permeabilized cells (Fig. 4, h and i). In cells dialyzed with P1-33 (10 nM) and 4Box (1 nM) through a patch pipette, at concentrations at which neither had activity on its own, the combination fully inhibited carbachol-evoked Ca2+ signaling (data not shown). Thus, the peptide P1-33 and 4Box mutually influenced the activity of each other in cells. We propose the P1-33 peptide facilitates 4Box interaction with the receptor complex (reflected by enhanced potency) and the 4Box alters the P1-33 binding site to relieve GTPgamma S-resistant inhibition. The analysis in Fig. 4 suggests two separate regions of RGS4 interact with the receptor complex to regulate Ca2+ signaling. A combination of the N-terminal peptide P1-33 and 4Box reconstituted the essential functions of RGS4, those of receptor specificity and GAP activity. Sequence divergence in the N terminus of different RGS proteins may convey regulatory specificity toward other receptor complexes, and this specificity may be retained in peptides analogous with P1-33.

Conclusions-- The N-terminal domain and RGS box of RGS4 cooperate via at least two discrete mechanisms to convey receptor-selective inhibition of G protein signaling. Inhibition of Ca2+ signaling by RGS4 was receptor-selective whereas inhibition by 4Box was not. Receptor selectivity of RGS4 inhibition was not influenced by the identity of the Gq class alpha  subunit.2 Such selectivity suggests intact RGS4 interacts directly or indirectly with receptors, most likely through its N terminus. This is supported by the finding that RGS4 in patch-clamped cells was 10,000-fold more potent than 4Box and RGS4 had 125-fold higher Gq-GAP activity than did 4Box in an agonist-dependent in vitro assay. Finally, partial inhibition by RGS4 simultaneously decreased both the amplitude of the initial Ca2+ signal and the frequency of subsequent oscillations, suggesting recombinant RGS4 protein is active when dialyzed into patch-clamped cells and can preassemble with the receptor-Gq-PLCbeta signaling complex. By contrast, 4Box preferentially inhibited signaling following the initial Ca2+ release evoked by carbachol and CCK. This suggests that 4Box is recruited only to active receptor complexes when production of the Gq-GTP substrate would be greatest, and thereby 4Box GAP activity would be most pronounced.

Interaction of the N terminus with components of the receptor-Gq-PLCbeta signaling complex is further supported by the ability of the N-terminal peptide P1-33 to inhibit Ca2+ signaling in the absence of 4Box. Inhibition by P1-33 displayed the same selectivity among receptors as displayed by full-length RGS4. In contrast to RGS4, however, inhibition by P1-33 was not overcome by GTPgamma S, possibly because P1-33 blocked access of Galpha q-GTPgamma S to its effector protein PLCbeta . Cooperation between the N terminus and 4Box is most apparent in that a combination of both P1-33 and 4Box restored the regulatory activity of intact RGS4 in cells, including its reversibility by GTPgamma S. Thus, the N terminus provides anchorage (4, 22) and receptor selectivity whereas the RGS box acts as a GAP, and both domains combine to yield the behavior of the intact protein.

Based on our results, we propose that receptor interactions with the N terminus of RGS4 may help position RGS4 between effector and G protein, where it is poised to inactivate the G protein alpha  subunit via the GAP activity of the RGS box, even in the presence of persistent agonist (Fig. 5). Subcellular co-localization of receptor, RGS proteins, and downstream signaling proteins, including Gq and PLCbeta , could provide an additional level of regulatory specificity. Thus, the multiple effects of RGS4 described here may contribute to the temporal and spatial regulation that is a hallmark of intracellular Ca2+ signaling.


View larger version (36K):
[in this window]
[in a new window]
 
Fig. 5.   Model of RGS4 interaction with the receptor signaling complex. We propose that the N terminus of RGS4 mediates high affinity interaction with Gq-coupled receptors. The RGS4 box provides Gq-GAP activity. RGS4 is modeled to reside within the complex on the path of Galpha q between the receptor, which catalyzes GTP binding in the presence of agonist, and the effector protein PLCbeta . We propose that active RGS4 accelerates GTP hydrolysis on Galpha q before its interaction with PLCbeta , thus inhibiting the production of IP3 and subsequent Ca2+ release.


    ACKNOWLEDGEMENTS

We thank Melanie Cobb, David Corey, Rama Ranganathan, Kai Zinn, and members of our laboratories for comments on the manuscript.

    FOOTNOTES

* This work was funded by a postdoctoral training fellowship and grants from the National Institutes of Health and by the R. A. Welch Foundation.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

§ These authors contributed equally to this work.

** Recipient of the American Heart Association Established Investigator Award. To whom correspondence should be addressed: Dept. of Pharmacology, UT-Southwestern, 5323 Harry Hines Blvd., Dallas, TX 75235-9041. E-mail: wilkie{at}utsw.swmed.edu.

The abbreviations used are: PLC, phospholipase C; IP3, inositol trisphosphate; RGS, regulators of G protein signaling; GAP, GTPase-activating protein; 4Box, RGS domain of RGS4; P1-33, N-terminal 33 amino acids of RGS4; Car, carbachol; CCK, cholecystokinin; GTPgamma S, guanosine 5'-3-O-(thio)triphosphate.

2 Xu, X., Zeng, W., Popov, S., Berman, D. M., Davignon, I., Yu, K., Yowe, D., Offermanns, S., Muallem, S., and Wilkie, T. M. (1999) J. Biol. Chem., in press.

3 P1-33, MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSC (Ro27-3948); P1-33CA2,12,33, MAKGLAGLPASALRSAKDMKHRLGFLLQKSDSA (Ro27-3949); P13-32, LRSAKDMKHRLGFLLQKSDS (Ro27-3950); HT-31, DLIEEAASRIVDAVIEQVKAAY (Ro27-1970).

    REFERENCES
Top
Abstract
Introduction
Materials & Methods
Results & Discussion
References

  1. Rhee, S. G., and Bae, Y. S. (1997) J. Biol. Chem. 272, 15045-15048[Free Full Text]
  2. Berridge, M. J. (1993) Nature 361, 315-325[CrossRef][Medline] [Order article via Infotrieve]
  3. Xu, X., Zeng, W., Diaz, J., and Muallem, S. (1996) J. Biol. Chem. 271, 24684-24690[Abstract/Free Full Text]
  4. Chen, C., and Lin, S. C. (1998) FEBS Lett. 422, 359-362[CrossRef][Medline] [Order article via Infotrieve]
  5. Berman, D. M., Wilkie, T. M., and Gilman, A. G. (1996) Cell 86, 445-452[CrossRef][Medline] [Order article via Infotrieve]
  6. Hunt, T. W., Fields, T. A., Casey, P. J., and Peralta, E. G. (1996) Nature 383, 175-177[CrossRef][Medline] [Order article via Infotrieve]
  7. Watson, N., Linder, M. E., Druey, K. M., Kehrl, J. H., and Blumer, K. J. (1996) Nature 383, 172-175[CrossRef][Medline] [Order article via Infotrieve]
  8. Hepler, J. R., Berman, D. M., Gilman, A. G., and Kozasa, T. (1997) Proc. Natl. Acad. Sci. U. S. A. 94, 428-432[Abstract/Free Full Text]
  9. Berman, D. M., Kozasa, T., and Gilman, A. G. (1996) J. Biol. Chem. 271, 27209-27212[Abstract/Free Full Text]
  10. Popov, S., Yu, K., Kozasa, T., and Wilkie, T. M. (1997) Proc. Natl. Acad. Sci. U. S. A. 94, 7216-7220[Abstract/Free Full Text]
  11. Tesmer, J. J., Berman, D. M., Gilman, A. G., and Sprang, S. R. (1997) Cell 89, 251-261[CrossRef][Medline] [Order article via Infotrieve]
  12. Srinivasa, S. P., Watson, N., Overton, M. C., and Blumer, K. J. (1998) J. Biol. Chem. 273, 1529-1533[Abstract/Free Full Text]
  13. Druey, K. M., Blumer, K. J., Kang, V. H., and Kehrl, J. H. (1996) Nature 379, 742-746[CrossRef][Medline] [Order article via Infotrieve]
  14. Biddlecome, G. H., Berstein, G., and Ross, E. M. (1996) J. Biol. Chem. 271, 7999-8007[Abstract/Free Full Text]
  15. Wang, J., Tu, Y., Mukhopadhyay, S., Chidiac, P., Biddlecome, G. H., and Ross, E. M. (1998) in G Proteins: Techniques of Analysis (Manning, D. R., ed), CRC Press, Inc., Boca Raton, FL, in press
  16. Petersen, O. H. (1992) J. Physiol. (Lond.) 448, 1-51[Free Full Text]
  17. Zeng, W., Xu, X., and Muallem, S. (1996) J. Biol. Chem. 271, 18520-18526[Abstract/Free Full Text]
  18. Chen, C. K., Wieland, T., and Simon, M. I. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 12885-12889[Abstract/Free Full Text]
  19. Chen, C., Zheng, B., Han, J., and Lin, S. C. (1997) J. Biol. Chem. 272, 8679-8685[Abstract/Free Full Text]
  20. Xu, X., Zeng, W., and Muallem, S. (1996) J. Biol. Chem. 271, 11737-11744[Abstract/Free Full Text]
  21. Hausken, Z. E., Coghlan, V. M., Hastings, C. A., Reimann, E. M., and Scott, J. D. (1994) J. Biol. Chem. 269, 24245-24251[Abstract/Free Full Text]
  22. Srinivasa, S. P., Bernstein, L. S., Blumer, K. J., and Linder, M. E. (1998) Proc. Natl. Acad. Sci. U. S. A. 95, 5584-5589[Abstract/Free Full Text]


Copyright © 1998 by The American Society for Biochemistry and Molecular Biology, Inc.



This article has been cited by other articles:


Home page
Proc. Natl. Acad. Sci. USAHome page
M. Soundararajan, F. S. Willard, A. J. Kimple, A. P. Turnbull, L. J. Ball, G. A. Schoch, C. Gileadi, O. Y. Fedorov, E. F. Dowler, V. A. Higman, et al.
Structural diversity in the RGS domain and its interaction with heterotrimeric G protein {alpha}-subunits
PNAS, April 29, 2008; 105(17): 6457 - 6462.
[Abstract] [Full Text] [PDF]


Home page
Mol. Pharmacol.Home page
J. Bodenstein, R. K. Sunahara, and R. R. Neubig
N-Terminal Residues Control Proteasomal Degradation of RGS2, RGS4, and RGS5 in Human Embryonic Kidney 293 Cells
Mol. Pharmacol., April 1, 2007; 71(4): 1040 - 1050.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
W. Liu, E. Y. Yuen, P. B. Allen, J. Feng, P. Greengard, and Z. Yan
Adrenergic modulation of NMDA receptors in prefrontal cortex is differentially regulated by RGS proteins and spinophilin
PNAS, November 28, 2006; 103(48): 18338 - 18343.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Jaen and C. A. Doupnik
RGS3 and RGS4 Differentially Associate with G Protein-coupled Receptor-Kir3 Channel Signaling Complexes Revealing Two Modes of RGS Modulation: PRECOUPLING AND COLLISION COUPLING
J. Biol. Chem., November 10, 2006; 281(45): 34549 - 34560.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J. Y. Kim, W. Zeng, K. Kiselyov, J. P. Yuan, M. H. Dehoff, K. Mikoshiba, P. F. Worley, and S. Muallem
Homer 1 Mediates Store- and Inositol 1,4,5-Trisphosphate Receptor-dependent Translocation and Retrieval of TRPC3 to the Plasma Membrane
J. Biol. Chem., October 27, 2006; 281(43): 32540 - 32549.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. Dowal, P. Provitera, and S. Scarlata
Stable Association between G{alpha}q and Phospholipase Cbeta1 in Living Cells
J. Biol. Chem., August 18, 2006; 281(33): 23999 - 24014.
[Abstract] [Full Text] [PDF]


Home page
Mol. Pharmacol.Home page
M. A. Clark and N. A. Lambert
Endogenous Regulator of G-Protein Signaling Proteins Regulate the Kinetics of G{alpha}q/11-Mediated Modulation of Ion Channels in Central Nervous System Neurons
Mol. Pharmacol., April 1, 2006; 69(4): 1280 - 1287.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
V. M. Tesmer, T. Kawano, A. Shankaranarayanan, T. Kozasa, and J. J. G. Tesmer
Snapshot of Activated G Proteins at the Membrane: The G{alpha}q-GRK2-G{beta}{gamma} Complex
Science, December 9, 2005; 310(5754): 1686 - 1690.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
C. Hague, L. S. Bernstein, S. Ramineni, Z. Chen, K. P. Minneman, and J. R. Hepler
Selective Inhibition of {alpha}1A-Adrenergic Receptor Signaling by RGS2 Association with the Receptor Third Intracellular Loop
J. Biol. Chem., July 22, 2005; 280(29): 27289 - 27295.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
N. Grillet, A. Pattyn, C. Contet, B. L. Kieffer, C. Goridis, and J.-F. Brunet
Generation and Characterization of Rgs4 Mutant Mice
Mol. Cell. Biol., May 15, 2005; 25(10): 4221 - 4228.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. Benians, M. Nobles, S. Hosny, and A. Tinker
Regulators of G-protein Signaling Form a Quaternary Complex with the Agonist, Receptor, and G-protein: A NOVEL EXPLANATION FOR THE ACCELERATION OF SIGNALING ACTIVATION KINETICS
J. Biol. Chem., April 8, 2005; 280(14): 13383 - 13394.
[Abstract] [Full Text] [PDF]


Home page
Anesth. Analg.Home page
G.-x. Xie and P. P. Palmer
RGS Proteins: New Players in the Field of Opioid Signaling and Tolerance Mechanisms
Anesth. Analg., April 1, 2005; 100(4): 1034 - 1042.
[Abstract] [Full Text] [PDF]


Home page
Mol. Pharmacol.Home page
S. C. Tovey and G. B. Willars
Single-Cell Imaging of Intracellular Ca2+ and Phospholipase C Activity Reveals That RGS 2, 3, and 4 Differentially Regulate Signaling via the G{alpha}q/11-Linked Muscarinic M3 Receptor
Mol. Pharmacol., December 1, 2004; 66(6): 1453 - 1464.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
T. M. Cabrera-Vera, S. Hernandez, L. R. Earls, M. Medkova, A. K. Sundgren-Andersson, D. J. Surmeier, and H. E. Hamm
RGS9-2 modulates D2 dopamine receptor-mediated Ca2+ channel inhibition in rat striatal cholinergic interneurons
PNAS, November 16, 2004; 101(46): 16339 - 16344.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
S. J. Bornheimer, M. R. Maurya, M. G. Farquhar, and S. Subramaniam
Computational modeling reveals how interplay between components of a GTPase-cycle module regulates signal transduction
PNAS, November 9, 2004; 101(45): 15899 - 15904.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
X. Wang, G. Huang, X. Luo, J. M. Penninger, and S. Muallem
Role of Regulator of G Protein Signaling 2 (RGS2) in Ca2+ Oscillations and Adaptation of Ca2+ Signaling to Reduce Excitability of RGS2-/- Cells
J. Biol. Chem., October 1, 2004; 279(40): 41642 - 41649.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
H. Mao, Q. Zhao, M. Daigle, M. H. Ghahremani, P. Chidiac, and P. R. Albert
RGS17/RGSZ2, a Novel Regulator of Gi/o, Gz, and Gq Signaling
J. Biol. Chem., June 18, 2004; 279(25): 26314 - 26322.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
L. S. Bernstein, S. Ramineni, C. Hague, W. Cladman, P. Chidiac, A. I. Levey, and J. R. Hepler
RGS2 Binds Directly and Selectively to the M1 Muscarinic Acetylcholine Receptor Third Intracellular Loop to Modulate Gq/11{alpha} Signaling
J. Biol. Chem., May 14, 2004; 279(20): 21248 - 21256.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
Z. Liu and R. A. Fisher
RGS6 Interacts with DMAP1 and DNMT1 and Inhibits DMAP1 Transcriptional Repressor Activity
J. Biol. Chem., April 2, 2004; 279(14): 14120 - 14128.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
A. M. Krumins, S. A. Barker, C. Huang, R. K. Sunahara, K. Yu, T. M. Wilkie, S. J. Gold, and S. M. Mumby
Differentially Regulated Expression of Endogenous RGS4 and RGS7
J. Biol. Chem., January 23, 2004; 279(4): 2593 - 2599.
[Abstract] [Full Text] [PDF]


Home page
Mol. Pharmacol.Home page
A. A. Roy, K. E. Lemberg, and P. Chidiac
Recruitment of RGS2 and RGS4 to the Plasma Membrane by G Proteins and Receptors Reflects Functional Interactions
Mol. Pharmacol., September 1, 2003; 64(3): 587 - 593.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. K. Chatterjee, Z. Liu, and R. A. Fisher
Human RGS6 Gene Structure, Complex Alternative Splicing, and Role of N Terminus and G Protein {gamma}-Subunit-like (GGL) Domain in Subcellular Localization of RGS6 Splice Variants
J. Biol. Chem., August 8, 2003; 278(32): 30261 - 30271.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
T. K. Chatterjee and R. A. Fisher
Mild Heat and Proteotoxic Stress Promote Unique Subcellular Trafficking and Nucleolar Accumulation of RGS6 and Other RGS Proteins: ROLE OF THE RGS DOMAIN IN STRESS-INDUCED TRAFFICKING OF RGS PROTEINS
J. Biol. Chem., August 8, 2003; 278(32): 30272 - 30282.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Biol.Home page
D. M. Shin, M. Dehoff, X. Luo, S. H. Kang, J. Tu, S. K. Nayak, E. M. Ross, P. F. Worley, and S. Muallem
Homer 2 tunes G protein-coupled receptors stimulus intensity by regulating RGS proteins and PLC{beta} GAP activities
J. Cell Biol., July 21, 2003; 162(2): 293 - 303.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
P. Tosetti, N. Pathak, M. H. Jacob, and K. Dunlap
RGS3 mediates a calcium-dependent termination of G protein signaling in sensory neurons
PNAS, June 10, 2003; 100(12): 7337 - 7342.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
J. L. Osterhout, A. A. Waheed, A. Hiol, R. J. Ward, P. C. Davey, L. Nini, J. Wang, G. Milligan, T. L. Z. Jones, and K. M. Druey
Palmitoylation Regulates Regulator of G-protein Signaling (RGS) 16 Function: II. PALMITOYLATION OF A CYSTEINE RESIDUE IN THE RGS BOX IS CRITICAL FOR RGS16 GTPase ACCELERATING ACTIVITY AND REGULATION OF Gi-COUPLED SIGNALING
J. Biol. Chem., May 23, 2003; 278(21): 19309 - 19316.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Salim, S. Sinnarajah, J. H. Kehrl, and C. W. Dessauer
Identification of RGS2 and Type V Adenylyl Cyclase Interaction Sites
J. Biol. Chem., April 25, 2003; 278(18): 15842 - 15849.
[Abstract] [Full Text] [PDF]


Home page