|
J Biol Chem, Vol. 274, Issue 36, 25330-25334, September 3, 1999
Antimicrobial Activity of a Bovine Hemoglobin Fragment in the
Tick Boophilus microplus*
Andréa C.
Fogaça ,
Pedro I.
da Silva Jr. §,
M.
Terêsa M.
Miranda¶,
Antonio G.
Bianchi ,
Antonio
Miranda ,
Paulo E. M.
Ribolla , and
Sirlei
Daffre **
From the Departamento de Parasitologia, Instituto de
Ciências Biomédicas, Universidade de São Paulo, Av.
Prof. Lineu Prestes, 1374, CEP 05508-900, the
§ Laboratório de Artrópodes, Instituto Butantan,
Av. Vital Brazil, 1500, CEP 05503-900, the ¶ Departamento de
Bioquímica, Instituto de Química, Universidade de
São Paulo, Av. Prof. Lineu Prestes, 748, CEP 05508-900, and the
Departamento de Biofísica, Universidade Federal de
São Paulo, Rua 03 de Maio, 100, CEP 04044-020, São Paulo,
Brazil
 |
ABSTRACT |
Antifungal and antibacterial activities were
detected in the hemolymph and gut contents of the cattle tick,
Boophilus microplus. A peptide with antibacterial activity
from the tick gut contents was purified to homogeneity by
reversed-phase chromatography. The molecular mass of the purified
peptide was 3,205.7 Da, measured by matrix-assisted laser
desorption/ionization mass spectrometry. The amino acid sequence was
obtained by Edman degradation and showed that the peptide was identical
to a fragment of the bovine -hemoglobin. A synthetic peptide based
on the sequence obtained showed characterization data identical to
those of the isolated material, confirming its structure. The synthetic
peptide was active in micromolar concentrations against Gram-positive
bacteria and fungi. These data led us to conclude that the
antibacterial activity detected in tick gut contents is the result of
enzymatic processing of a host protein, hemoglobin. This activity may
be used by ticks as a defense against microorganisms.
 |
INTRODUCTION |
Ticks are obligatory blood-sucking arthropods found
throughout the world and are among the most important vectors of human and animal diseases. The diversity of pathogenic organisms transmitted by ticks includes fungi, viruses, rickettsiae, bacteria, and protozoa and exceeds that found in all other arthropods (1). It is intriguing how many different organisms survive inside the ticks, and little is
known about the mechanisms they use to avoid recognition by the defense
system of the vector.
Animals defend themselves against microorganisms and parasites through
a number of cellular and humoral mechanisms. Antimicrobial peptides
belong to the latter class, and despite the fact that these peptides
are very well characterized in insects and limulus (2, 3), they are
poorly studied in arachnids. The first biochemical study of
antimicrobial peptides in arachnids showed the presence of an
antibacterial peptide in the hemolymph of the scorpion, Leiurus
quinquestriatus (4). The sequence of the isolated peptide has a
high similarity to that of a defensin isolated from the dragonfly,
Aeschna cyanea, which belongs to an ancient insect order,
Odonata. Three distinct antimicrobial peptides were isolated and
characterized from another scorpion, Androctonus australis
(5). Two of them are new peptides, androctonin and buthinin, and the
other one is a representative of the insect defensin. Recently,
lycotoxins I and II, which have been identified in the venom of the
spider, Lycosa carolinensis, have shown potent antimicrobial
activity against both prokaryotic and eukaryotic cells (6). Two
hemolymph factors of the tick, Dermacentor variabilis, have
activity against Bacillus subtilis (7). One of these factors has a molecular mass of 14.5 kDa and was tentatively identified as
lysozyme, in agreement with the work of Kuhn and Haug (8) which showed
a lysozyme-like immunoreactivity in tick hemocytes. This antibacterial
activity was increased significantly after challenge with bacteria
(7).
We studied antimicrobial active compounds originating in the tick,
Boophilus microplus. This tick is an ectoparasite of cattle and a vector of pathogens such as Babesia bigemmina,
Babesia bovis, and Anaplasma marginale. In
addition, B. microplus causes severe production losses
because its bites usually result in bovine blood loss and leather
damage (1). We propose that a knowledge of these antimicrobial
compounds will lead to better control of ticks and of the pathogens
they transmit. Here we report that the antimicrobial activity present
in gut contents of the tick is a fragment of the bovine
-hemoglobin.
 |
EXPERIMENTAL PROCEDURES |
Ticks--
The B. microplus colony (Porto Alegre
strain, Babesia sp. free) was obtained from the
Biotechnology Department and Center of Rio Grande do Sul, Brazil. Ticks
were reared on Holstein-Friesian calves in the Animal Facilities at the
Biomedical Sciences Institute of São Paulo University, Brazil.
Partially engorged adult females were removed from the host after
approximately 21 days post-infestation and were used for all subsequent
hemolymph collections and inoculation experiments. Fully engorged adult
females dropped from the host were used for gut contents collection.
Microorganisms--
Bacillus megaterium (ATCC 10778),
B. subtilis (ATCC 6633), Saccharomyces cerevisiae
(ATCC 26108), Serratia marcescens (ATCC 4112), and
Staphylococcus epidermidis (ATCC 12228) were obtained from
the American Type Culture Collection. Pseudomonas aeruginosa (IAL1025) was obtained from Adolfo Lutz Institute Culture Collection, São Paulo, Brazil. Escherichia coli D31 and
Enterobacter cloacae K12 were provided by Dr. H. G. Boman, Stockholm University, Sweden. E. coli SBS 363, Micrococcus luteus A270, and Neurospora crassa were obtained from Dr. P. Bulet, CNRS, Strasbourg, France. M. luteus was obtained from the Pharmaceutic Sciences Institute of São Paulo University, Brazil. Aspergillus nidulans
(UT448) was obtained from the Utrecht University Collection, Holland.
Candida albicans (MDM8) was obtained from the Microbiology
Department Collection, Biomedical Sciences Institute of São Paulo
University, Brazil.
Hemolymph and Gut Contents Collections--
For hemolymph
collections, a small cut was made with a hypodermic needle on the
dorsal cuticle at the posterior region of the ticks. Hemolymph was
recovered with a glass capillary after gentle pressure to the body of
the tick. Hemolymph samples were stored at 20 °C. The gut contents
were obtained from ticks within 24 h from the time they had
dropped from the calves. The gut contents were collected using a
Pasteur pipette, diluted 1:1 (v/v) with 0.15 M ammonium
acetate buffer, pH 7.0, and stored at 20 °C.
Bacteria Inoculation--
One µl of bacterial suspension
(102 105 cells) was injected into the
spiracles, anus, or genital apertures of partially engorged ticks with
a Hamilton syringe. Different bacteria strains, M. luteus,
E. cloacae, or E. coli, were inoculated.
Hemolymph collected at 2, 24, 48, and 72 h post-inoculation was
either streaked onto agar plates for bacterial growth detection or
stored at 20 °C for antibacterial activity analysis.
Acidic Extract of Neutrophil Granules--
Granulocytes were
isolated from bovine blood as described by Carlson and Kaneko (9).
Neutrophils granules were obtained according to Genaro et
al.(10) and extracted for 2 h in an ice bath with 0.2 M sodium acetate buffer, pH 4.0, containing 5 mM EDTA. The pH was adjusted to 7.0 with 6 N NaOH, and the
insoluble material was sedimented by centrifugation for 10 min at
10,000 × g. The resulting supernatant was analyzed for
antibacterial activity.
Erythrocyte Lysis in Vitro--
Erythrocytes were isolated from
EDTA-anticoagulated bovine blood using a Ficoll-paque (Amersham
Pharmacia Biotech) gradient according to the manufacturer. After
centrifugation (400 × g, 30 min, 22 °C), the cell
suspension was washed and suspended in phosphate-buffered saline
(2.6 × 1010 cells/ml). Erythrocytes were lysed as
described by Carlson and Kaneko (9), and the supernatant was
concentrated 2.5 times in a vacuum centrifuge.
Antimicrobial Assays--
Two different approaches were used to
evaluate the antibacterial activity, an inhibition zone assay (11), and
a liquid growth inhibition assay (12). The liquid growth inhibition
assay was used for the determination of the minimal inhibitory
concentration of the synthetic peptide. The lowest concentration that
caused 100% of growth inhibition was recorded. The antifungal activity was detected using the liquid growth inhibition assay described in
Fehlbaum et al. (13). The concentrations tested for
synthetic peptide were in the range of 0.65-21 µM.
Bactericidal Assay--
A M. luteus culture was
incubated with different concentrations of gut contents or synthetic
peptide using the assay described by Bulet et al.(12). The
culture that had total growth inhibition at the lowest concentration of
the samples was plated on nutrient agar. The number of colony-forming
units was determined after an overnight incubation at 37 °C. The
synthetic peptide was tested at the concentration in the range of
0.65-21 µM, and the gut contents were diluted from 80 to
1280 times.
Purification of Antibacterial Peptide from Gut Contents--
The
gut contents (10 ml) collected from fully engorged ticks was mixed with
0.15 M ammonium acetate buffer, pH 7.0 (1:1, v/v), and
concentrated in a vacuum centrifuge. The dried material was suspended
in 0.1% trifluoroacetic acid
(TFA)1 and heated to 80 °C
for 10 min. After centrifugation at 8,000 × g for 30 min at 4 °C, the supernatant was loaded onto reversed-phase Sep-Pak
C18 cartridges equilibrated with 5% acetonitrile (ACN) in
0.1% TFA. The elution was performed with different concentrations (20, 30, 40, and 95%) of ACN in 0.1% TFA. The antibacterial peptide eluted
in 30% ACN was purified to homogeneity by reversed-phase chromatography in HPLC. The column effluent was monitored by absorbance at 214 nm, and the presence of antibacterial activity was determined by
the inhibition zone assay.
Mass Spectrometry Analysis--
The peptides dissolved in
acidified water (0.1% TFA) were analyzed by matrix-assisted laser
desorption/ionization (MALDI) mass spectrometry using the matrix
-cyano-4-hydroxycinnamic acid. Positive ion MALDI mass spectra were
acquired on a Bruker BIFLEX time-of-flight mass spectrometer (isolated
peptide from the tick) and on a Micromass spectrometer model TofSpec
S.E. (synthetic peptide).
N-terminal Amino Acid Sequencing--
Automated Edman
degradation of the pure isolated peptide and detection of
phenylthiohydantoin derivatives were performed on a pulse liquid
automatic sequenator (Applied Biosystems, Model 473A).
Peptide Synthesis--
The peptide was synthesized manually by
using the t-Boc strategy on a methylbenzhydrylamine (MBHA)
resin (substitution level of 0.79 mmol/g) (14, 15). The
t-Boc amino acids were protected as follows: Lys
( -2-Cl-Z), Ser (Bzl), Tyr (2-Br-Z), Thr (Bzl), His (Tos)DCHA, and
Asp ( -OcHex). After peptide chain assembly was completed, the
resulting peptide resin was treated with HF, 1% anisol for 90 min at
0 °C on Peptide Institute Inc. Teflon equipment. The crude peptide
was precipitated with anhydrous diethyl ether and extracted with 5%
acetic acid, and the resulting solution was lyophilized. Purification
of 360 mg of the crude peptide was achieved on a semipreparative Vydac
C18 column using a linear gradient of 15-33% ACN in 0.1%
TFA at a flow rate of 8 ml/min. The fractions containing the peptide as
determined by analytical reversed-phase HPLC under isocratic conditions
(1.4 ml/min, 28% ACN in 0.1% TFA) were pooled and lyophilized.
Peptide purity and identity were confirmed by reversed-phase HPLC,
amino acid analysis, and MALDI-TOF mass spectrometry measurement. Amino
acid analysis was performed on a 7300 Beckman analyzer after 24 h
6 N HCl hydrolysis in a PicoTag workstation (Waters).
 |
RESULTS |
Antimicrobial Activity of Tick Hemolymph and Gut
Contents--
Antibacterial and antifungal activities were detected in
the hemolymph and gut contents of noninfected adult ticks, B. microplus (Table I). The
antibacterial activity was detected only against Gram-positive strains.
The antifungal activity was observed against two filamentous fungi,
A. nidulans and N. crassa, and against the yeast,
C. albicans.
View this table:
[in this window]
[in a new window]
|
Table I
Antimicrobial activity spectrum of tick neutrophil and samples
Hemolymph (H) (2 µl) and gut contents (G) (2 µl) from ticks and
neutrophil granules (N) from bovine were applied in the wells of thin
agar plates containing bacteria. After the incubation of the plates
overnight, the diameters of the inhibition zone were recorded. The
antifungal activity was evaluated by the liquid inhibition assay.
Hemolymph (10 µl) and gut contents (10 µl) were applied into wells
of a microplate and incubated for 48 h. Growth of fungi was
observed microscopically. ND, activity not detected.
|
|
The level of antibacterial activity found in the hemolymph does not
increase after inoculations of 102-105 of
M. luteus, E. cloacae, or E. coli
cells via injection into the spiracle, anus, or genital aperture (data
not shown). We interpret this to indicate that the antibacterial
activity in the tick is constitutive and does not respond to bacterial inoculation.
We analyzed the number of bacteria in inoculated adult ticks by
streaking hemolymph onto agar plates. The number of bacteria in the
hemolymph markedly decreased after 24-48 h inoculation (data not shown).
Neutrophil granules have a marked antibacterial activity (10, 16). We
investigated the possibility that the antibacterial activity found in
tick hemolymph and gut contents originated from cells present in the
host blood. Using the inhibition zone assay, we showed that bovine
cells are active against Gram-positive and Gram-negative bacteria while
the tick preparations are active only against Gram-positive bacteria,
indicating that the tick antibacterial activity most likely does not
come from the bovine neutrophils (Table I).
Purification and Characterization of an Antimicrobial Peptide from
Gut Contents--
To isolate the active material from the gut
contents, 10 ml of a sample collected from fully engorged females were
loaded onto reversed-phase Sep-Pak C18 cartridges
equilibrated with 5% acidified ACN. The active fraction eluted with
30% ACN was loaded on a HPLC column Resource-RPC (Amersham Pharmacia
Biotech) using a linear gradient of 12-36% ACN in 0.1% TFA over 30 min (Fig. 1A). The active
fraction eluted with 31.5% acetonitrile was then loaded on a Pep-RPC
(Amersham Pharmacia Biotech) using a linear gradient of 12-48% ACN in
0.1% TFA over 30 min (Fig. 1B). The active fraction eluted
at 30.7% ACN was reloaded on the same column with a gradient of
15-33% ACN in 0.1% TFA over 30 min (Fig. 1C). The active
fraction eluted with 27% ACN was finally purified to homogeneity on a
Vydac C18 reversed-phase column with a gradient of 3-57%
ACN in 0.1% TFA over 30 min (Fig. 1D).

View larger version (23K):
[in this window]
[in a new window]
|
Fig. 1.
Purification of antibacterial factor from
tick gut contents by reversed-phase HPLC. An acidic extract
obtained from gut contents was submitted to solid-phase extraction on
Sep-Pak C18 cartridges. The fraction eluted with 30% ACN
was analyzed on a Resource-RPC column with a linear gradient of ACN in
0.1% TFA (A). The active fraction eluted with 31.5% ACN
was analyzed on a Pep-RPC column with a linear gradient of ACN in 0.1%
TFA (B). The active fraction eluted with 30.7% ACN was then
purified on the same column with a different linear gradient of ACN
described in the previous step (C). The active fraction
eluted with 27% of ACN was finally purified on a Vydac C18
reversed-phase column with a linear gradient of ACN in 0.1% TFA.
(D). Elution was performed at a flow rate of 1.0 ml/min. The
black area indicates the fractions active against M. luteus using inhibition zone assay.
|
|
The molecular mass of the purified peptide, eluted with 40.8%
acetonitrile, was 3,205.7 Da measured by MALDI-TOF mass spectrometry. The peak at 1,601.7 Da corresponds to the double charged ion (Fig. 2A). Edman degradation yielded
the following peptide sequence of 29 amino acids:
FLSFPTTKTYFPHFDLSHGSAQVKGHGAK. The theoretical molecular mass and pI
are 3,206.6 and 9.53, respectively, calculated by the pI/Mw program at
ExPASy (Molecular Biology Server of the Geneva University Hospital and
the University of Geneva, Switzerland). The comparison of this peptide
with a Swiss Protein Database showed 100% identity to the bovine
-hemoglobin fragment 33-61.

View larger version (15K):
[in this window]
[in a new window]
|
Fig. 2.
Comparative mass spectrometry analysis of the
native and the synthetic bovine -hemoglobin
fragments. The antibacterial peptide purified from tick gut
contents (Fig. 1D) (A) and the synthetic peptide
(B) were analyzed by MALDI-TOF mass spectrometry in the
conditions described under "Experimental Procedures."
|
|
Synthetic Peptide--
With the aim of confirming the identity and
biological properties of the isolated peptide, we synthesized this
peptide corresponding to the -hemoglobin fragment (33-61). Purity
of the synthetic peptide was confirmed by reversed phase-HPLC (90-95%
pure), mass spectrometry measurement, and amino acid analysis. The
molecular mass obtained by MALDI-TOF was 3,204.3 Da (Fig.
2B). The amino acid analysis results, with the expected
values given in parentheses, were: Asp, 1.03 (1.00); Glu, 1.06 (1.00);
Gly, 3.01 (3.00); Ala, 2.25 (2.00); Tyr, 0.83 (1.00); Val, 0.77 (1.00);
Thr, 2.79 (3.00); Ser, 2.28 (3.00); Pro, 1.16 (2.00); Leu, 2.65 (2.00); Phe, 3.29 (4.00); Lys, 3.02 (3.00); and His, 2.93 (3.00). The
synthetic peptide in micromolar concentrations was found to be active
against all Gram-positive bacteria tested as well as against two
different species of yeast and one filamentous fungi (Table
II). Furthermore, intact bovine
hemoglobin does not have activity against M. luteus in
concentrations up to 30 µM.
View this table:
[in this window]
[in a new window]
|
Table II
Antimicrobial activity spectrum of synthetic hemoglobin fragment
The minimal inhibitory concentrations (MICs) of the synthetic peptide
were determined by liquid growth inhibition. The lowest concentration
that causes 100% of growth inhibition was recorded. The highest
concentration tested was 21 µM. ND, activity not detected.
|
|
Bactericidal Effect of the Synthetic Peptide and Gut
Contents--
The incubations of the M. luteus culture with
the synthetic peptide (5 µM) or the gut contents (diluted
320 times) showed total growth inhibition. They were platted on
nutrient agar, and no colony-forming unit was detected after overnight
incubation, indicating that the effect of both samples is bactericidal.
Antibacterial Activity of Erythrocytes Lysed in Vitro--
We
investigated whether erythrocytes lysed in vitro have
antibacterial activity because it is known that extensive proteolytic degradation of hemoglobin takes place inside these cells (17). The
sample containing lysed erythrocytes was analyzed in liquid growth
inhibition assay (12). No activity against the bacterial strain tested
(M. luteus) was observed.
 |
DISCUSSION |
Antimicrobial proteins and peptides constitute an important part
of the humoral immune system of arthropods. In this study, we detected
antimicrobial activity in the hemolymph and gut contents of noninfected
ticks. This activity is not increased in the hemolymph of
experimentally bacteria-infected ticks, and we conclude that it is
constitutive as opposed to the induction observed in insects. Similar
results were reported in other arachnids, such as the scorpion,
A. australis (5). In contrast, Johns et al. (7) observed an increase of antibacterial activity in the hemolymph of the
bacteria-infected tick D. variabilis.
A peptide with activity against M. luteus was purified from
the gut contents to homogeneity by reversed-phase chromatography. The
amino acid sequence showed that it was a fragment (33-61) of the
bovine -hemoglobin. The synthetic peptide showed characterization data identical to those of the isolated native peptide, confirming its
identity by mass spectrometry measurement and amino acid analysis. It
was active against Gram-positive bacteria and fungi in micromolar concentrations, being bactericidal on our tested bacteria strain (M. luteus). The predicted secondary structure of the
peptide does not display amphipathic alpha-helix character typical of basic antimicrobial pore-forming peptide structure (18, 19). An
investigation of the structural requirements of the -hemoglobin fragment 33-61 would be important for the understanding of its antimicrobial activity.
Whole hemoglobin did not show antibacterial activity in our experiments
although an early report by Hobson and Hirsch (20) showed such activity
in vitro. However, according to these authors an
antimicrobial function in vivo is unlikely because the
conditions used in the assays are so far from those existing in tissues.
In a recent review, Ivanov et al. (17) discussed the role of
hemoglobin as a source of biologically active peptides. Apparently, the
generation of hemoglobin fragments starts inside the erythrocytes. The
primary proteolysis gives rise to peptides with 30 amino acid residues.
The next processing step occurs with the excretion of newly formed
shorter peptides from the erythrocytes. The function of these peptides
would be regulatory and complementary to the conventional hormonal and
neuromodulatory systems.
More than 150 established amino acid sequences of endogenous hemoglobin
fragments are available; however, in no case has an antibacterial
activity been mentioned. A literature search for hemoglobin fragments
that have some structural identity to the peptide isolated from the
tick gut contents revealed six peptides: one isolated from pig
hypothalamus (21), three others from human cerebellum (22), and two
from rat hippocampus (23) (Table III).
The pig hypothalamus peptide (PHP) includes the amino acid residues
corresponding to fragment 33-46 of the -hemoglobin and has an
activity related to release of corticotropin in vitro (21). The human cerebellum peptides (HCP1, HCP2, and HCP3) have sequences starting at amino acid residue 33 of -hemoglobin, but the C-terminal amino acids are not known (they have been used as peptide markers of
Alzheimer's disease) (22). The rat hippocampus peptides (RHP1 and
RHP2) sequences are not completely defined and have been used as
markers of ischemia (23).
View this table:
[in this window]
[in a new window]
|
Table III
Amino acid sequences of -hemoglobin fragments
Biologically active peptides originated from -hemoglobin: bovine
hemoglobin peptide (BHP), pig hypothalamus peptide (PHP) (21), human
cerebellum peptides (HCP1, HCP2, and HCP3) (22), and rat hippocampus
peptides (RHP1 and RHP2) (23).
|
|
Because we were not able to detect any antibacterial activity against
M. luteus in lysed erythrocytes, we suppose that the active
hemoglobin fragment is originated inside the tick gut, probably through
enzymatic cleavage at phenylalanine residue. It has been reported that
globin in the Schistosoma mansoni gut is degraded to
peptides containing phenylalanine at their amino-terminal residue by a
hemoglobinase (24). We are currently interested in purifying and
characterizing the putative enzyme responsible for the hemoglobin
degradation to antimicrobial peptides.
The function of hemoglobin as source of amino acids for blood-sucking
insects and ticks is well known. In addition, hemoglobin may be
utilized as a regulatory molecule. Azambuja et al. (25) showed that hemoglobin is important for ecdysteroid production and for
the establishment of the ecdysis process in the hematophagous triatomine insect Rhodnius prolixus. Fraidenraich et al.
(26) purified a peptide corresponding to residues 1-40 of the D
globin chain of chicken from Triatoma hindgut. This peptide induced the differentiation of T. cruzi epimastigotes to metacyclic
trypomastigotes in vitro, through activation of adenylyl
cyclase. Garcia et al. (27) showed that hemoglobin and
synthetic peptides corresponding to 30-49 and 35-73 of the D
globin chain induced T. cruzi metacyclogenesis in the
R. prolixus gut. It would be interesting to study the effect of the synthetic peptide ( -hemoglobin fragment 33-61) on the development of B. bovis and B. bigemmina, the
protozoa transmitted by B. microplus to the cattle (1).
In conclusion, we propose that the ticks utilize a host protein,
hemoglobin, to its own defense against microorganisms. The utilization
of host proteins for microorganism defense could be a mechanism used by
other ticks, because a rabbit lysozyme in the tick
Ornithodorus hemolymph has been
purified.2 We do not know if
the hemoglobin fragment that we have isolated from the gut contents and
characterized in this study is also present in the hemolymph. It is
known, however, that proteins from the host blood pass directly from
the gut contents into the tick hemolymph, either intact or separated
into subunits (28). Because of this, we are now investigating the
possible recovery of this peptide from tick hemolymph. Finally, we are
considering whether the hemoglobin fragment can have antimicrobial
function in vertebrates, this could be an important effector of the
innate immune response to kill microbial invaders.
 |
ACKNOWLEDGEMENTS |
We are grateful to Dr. Philippe Bulet
(Institut de Biologie Moléculaire et Cellulaire, CNRS,
Strasbourg, France) and Dr. Anthony A. James (University of California,
Irvine, USA) for the critical reading of the manuscript. We thank also
Dr. P. Bulet for amino acid sequencing and MALDI-TOF analysis of
peptide and Susana Pessoa de Lima for technical assistance.
 |
FOOTNOTES |
*
This work was supported by grants from Fundação
de Amparo à Pesquisa do Estado de São Paulo (FAPESP) and
Conselho Nacional de Desenvolvimento Científico e
Tecnológico (CNPq).The costs of publication of this
article were defrayed in part by the
payment of page charges. The article
must therefore be hereby marked
"advertisement" in
accordance with 18 U.S.C. Section
1734 solely to indicate this fact.
**
To whom correspondence should be addressed. Tel.: 55 11 8187272;
Fax: 55 11 8187417; E-mail: sidaffre@icb.usp.br.
2
S. Chernysh, personal communication.
 |
ABBREVIATIONS |
The abbreviations used are:
TFA, trifluoroacetic
acid;
ACN, acetonitrile;
HPLC, high performance liquid chromatography;
MALDI, matrix-assisted laser desorption/ionization;
TOF, time of
flight.
 |
REFERENCES |
| 1.
|
Sonenshine, D. E.
(1991)
Biology of Ticks
, pp. 3-12, Oxford University Press, New York/Oxford
|
| 2.
|
Hetru, C.,
Hoffmann, D.,
and Bulet, P.
(1997)
in
Molecular Mechanisms of Immune Response in Insects
(Brey, P. T.
, and Hultmark, D., eds)
, pp. 40-66, Chapman & Hall, London
|
| 3.
|
Iwanaga, S.,
Kawabata, S.,
and Muta, T.
(1998)
J. Biochem.
123,
1-15[Abstract/Free Full Text]
|
| 4.
|
Cociancich, S.,
Goyffon, M.,
Bontems, F.,
Bulet, P.,
Bouet, F.,
Menez, A.,
and Hoffmann, J. A.
(1993)
Biochem. Biophys. Res. Commun.
194,
17-22[CrossRef][Medline]
[Order article via Infotrieve]
|
| 5.
|
Ehret-Sabatier, L.,
Loew, D.,
Goyffon, M.,
Fehlbaum, P.,
Hoffmann, J. A.,
van Dorsselaer, A.,
and Bulet, P.
(1996)
J. Biol. Chem.
271,
29537-29544[Abstract/Free Full Text]
|
| 6.
|
Yan, L.,
and Adams, M.
(1998)
J. Biol. Chem.
273,
2059-2066[Abstract/Free Full Text]
|
| 7.
|
Johns, R.,
Sonenshine, D. E.,
and Hynes, W. L.
(1998)
J. Med. Entomol.
35,
458-464[Medline]
[Order article via Infotrieve]
|
| 8.
|
Kuhn, K. H.,
and Haug, T.
(1994)
Cell Tissue Res.
277,
493-504[CrossRef]
|
| 9.
|
Carlson, G. P.,
and Kaneko, J. J.
(1973)
Proc. Soc. Exp. Biol. Med.
142,
853-856[CrossRef][Medline]
[Order article via Infotrieve]
|
| 10.
|
Gennaro, R.,
Dolzani, L.,
and Romeo, D.
(1983)
Infect. Immun.
40,
684-690[Abstract/Free Full Text]
|
| 11.
|
Hoffmann, D.,
Hultmark, D.,
and Boman, H. G.
(1981)
Insect Biochem.
11,
537-548[CrossRef]
|
| 12.
|
Bulet, P.,
Dimarcq, J. L.,
Hetru, C.,
Lagueux, M.,
Charlet, M.,
Hegy, G.,
Van Dorsselaer, A.,
and Hoffmann, J. A.
(1993)
J. Biol. Chem.
268,
14893-14897[Abstract/Free Full Text]
|
| 13.
|
Fehlbaum, P.,
Bulet, P.,
Michaut, L.,
Lagueux, M.,
Broekaert, W. F.,
Hetru, C.,
and Hoffmann, J. A.
(1994)
J. Biol. Chem.
269,
33159-33163[Abstract/Free Full Text]
|
| 14.
|
Miranda, A.,
Koerber, S. C.,
Gulyas, J. L., S. L.,
Craig, A. G.,
Corrigan, A.,
Hagler, A.,
Rivier, C.,
Vale, W.,
and Rivier, J.
(1994)
J. Med. Chem.
37,
1450-1459[CrossRef][Medline]
[Order article via Infotrieve]
|
| 15.
|
Varanda, L. M.,
and Miranda, M. T. M.
(1997)
J. Pept. Res.
50,
102-108
[Medline]
[Order article via Infotrieve] |
| 16.
|
Gennaro, R.,
Skerlavaj, B.,
and Romeo, D.
(1989)
Infect. Immun.
57,
3142-3146[Abstract/Free Full Text]
|
| 17.
|
Ivanov, V. T.,
Karelin, A. A.,
Philippova, M. M.,
Nazimov, I. V.,
and Pletnev, V. Z.
(1997)
Biopolymers
43,
171-188[CrossRef][Medline]
[Order article via Infotrieve]
|
| 18.
|
Chou, P. Y.,
and Fasman, G. D.
(1974)
Biochemistry
13,
222-245[CrossRef][Medline]
[Order article via Infotrieve]
|
| 19.
|
Garnier, J.,
Osguthorpe, D. J.,
and Robson, B.
(1978)
J. Mol. Biol.
120,
97-120[CrossRef][Medline]
[Order article via Infotrieve]
|
| 20.
|
Hobson, D.,
and Hirsch, J. G.
(1958)
J. Exp. Med.
107,
167-183[Abstract]
|
| 21.
|
Schally, A. V.,
Huang, W. Y.,
Redding, T. W.,
Arimura, A.,
Coy, D. H.,
Chihara, K.,
Chang, R. C.,
Raymond, V.,
and Labrie, F.
(1978)
Biochem. Biophys. Res. Commun.
82,
582-588[CrossRef][Medline]
[Order article via Infotrieve]
|
| 22.
|
Slemmon, J. R.,
Hughes, C. M.,
Campbell, G. A.,
and Flood, D. G.
(1994)
J. Neurosci.
14,
2225-2235[Abstract]
|
| 23.
|
Slemmon, J. R.,
Wengenack, T. M.,
and Flood, D. G.
(1997)
Biopolymers
43,
157-170[CrossRef][Medline]
[Order article via Infotrieve]
|
| 24.
|
Sauer, M. C.,
and Senft, A. W.
(1972)
Comp. Biochem. Physiol.
42,
205-220[CrossRef]
|
| 25.
|
Azambuja, P.,
Feder, D.,
and Garcia, E. S.
(1993)
J. Insect Physiol.
29,
833-837
|
| 26.
|
Fraidenraich, D.,
Pena, C.,
Isola, E. L.,
Lammel, E. M.,
Coso, O.,
Anel, A. D.,
Pongor, S.,
Baralle, F.,
Torres, H. N.,
and Flawia, M. M.
(1993)
Proc. Natl. Acad. Sci. U. S. A.
90,
10140-10144[Abstract/Free Full Text]
|
| 27.
|
Garcia, E. S.,
Gonzalez, M. S.,
Azambuja, P.,
Baralle, F. E.,
Fraidenraich, D.,
Torres, H. N.,
and Flawia, M. M.
(1995)
Exp. Parasitology.
81,
255-261
[CrossRef][Medline]
[Order article via Infotrieve] |
| 28.
|
Ben Yakir, D.
(1989)
J. Med. Entomol.
26,
243-246[Medline]
[Order article via Infotrieve]
|
Copyright © 1999 by The American Society for Biochemistry and Molecular Biology, Inc.

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
This article has been cited by other articles:

|
 |

|
 |
 
L. Deng, X. Pan, Y. Wang, L. Wang, X. E Zhou, M. Li, Y. Feng, Q. Wu, B. Wang, and N. Huang
Hemoglobin and its derived peptides may play a role in the antibacterial mechanism of the vagina
Hum. Reprod.,
January 1, 2009;
24(1):
211 - 218.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. M. Ceraul, S. M. Dreher-Lesnick, A. Mulenga, M. S. Rahman, and A. F. Azad
Functional Characterization and Novel Rickettsiostatic Effects of a Kunitz-Type Serine Protease Inhibitor from the Tick Dermacentor variabilis
Infect. Immun.,
November 1, 2008;
76(11):
5429 - 5435.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
N. Tsuji, B. Battsetseg, D. Boldbaatar, T. Miyoshi, X. Xuan, J. H. Oliver Jr., and K. Fujisaki
Babesial Vector Tick Defensin against Babesia sp. Parasites
Infect. Immun.,
July 1, 2007;
75(7):
3633 - 3640.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. M. Ceraul, S. M. Dreher-Lesnick, J. J. Gillespie, M. S. Rahman, and A. F. Azad
New Tick Defensin Isoform and Antimicrobial Gene Expression in Response to Rickettsia montanensis Challenge
Infect. Immun.,
April 1, 2007;
75(4):
1973 - 1983.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Vergote, P.-E. Sautiere, F. Vandenbulcke, D. Vieau, G. Mitta, E. R. Macagno, and M. Salzet
Up-regulation of Neurohemerythrin Expression in the Central Nervous System of the Medicinal Leech, Hirudo medicinalis, following Septic Injury
J. Biol. Chem.,
October 15, 2004;
279(42):
43828 - 43837.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. G. Valenzuela, I. M. B. Francischetti, V. M. Pham, M. K. Garfield, T. N. Mather, and J. M. C. Ribeiro
Exploring the sialome of the tick Ixodes scapularis
J. Exp. Biol.,
September 15, 2002;
205(18):
2843 - 2864.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Destoumieux-Garzon, D. Saulnier, J. Garnier, C. Jouffrey, P. Bulet, and E. Bachere
Crustacean Immunity. ANTIFUNGAL PEPTIDES ARE GENERATED FROM THE C TERMINUS OF SHRIMP HEMOCYANIN IN RESPONSE TO MICROBIAL CHALLENGE
J. Biol. Chem.,
December 7, 2001;
276(50):
47070 - 47077.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
P. I. Silva Jr., S. Daffre, and P. Bulet
Isolation and Characterization of Gomesin, an 18-Residue Cysteine-rich Defense Peptide from the Spider Acanthoscurria gomesiana Hemocytes with Sequence Similarities to Horseshoe Crab Antimicrobial Peptides of the Tachyplesin Family
J. Biol. Chem.,
October 20, 2000;
275(43):
33464 - 33470.
[Abstract]
[Full Text]
[PDF]
|
 |
|
Copyright © 1999 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|