JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Nagano, K.
Right arrow Articles by Takenawa, T.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Nagano, K.
Right arrow Articles by Takenawa, T.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

J Biol Chem, Vol. 274, Issue 5, 2872-2879, January 29, 1999


A Novel Phospholipase C delta 4 (PLCdelta 4) Splice Variant as a Negative Regulator of PLC*

Kohji NaganoDagger , Kiyoko FukamiDagger , Tetsuya MinagawaDagger , Yutaka Watanabe§, Choichiro Ozaki§, and Tadaomi TakenawaDagger

From the Dagger  Department of Biochemistry, Institute of Medical Science, University of Tokyo, Tokyo 108-8639, and the § Faculty of Technology, Ehime University, Matsuyama 790-8577, Japan

    ABSTRACT
Top
Abstract
Introduction
References

It has been reported that there are two alternatively spliced variants of phospholipase C-delta 4 (PLCdelta 4), termed ALT I and II, that contain an additional 32 and 14 amino acids in their respective sequences in the linker region between the catalytic X and Y domains (Lee, S. B., and Rhee, S. G. (1996) J. Biol. Chem. 271, 25-31). We report here the isolation and characterization of a novel alternative splicing isoform of PLCdelta 4, termed ALT III, as a negative regulator of PLC. In ALT III, alternative splicing occurred in the catalytic X domain, i.e. 63 amino acids (residues 424-486) containing the C-terminal of the X domain and linker region were substituted for 32 amino acids corresponding to the insert sequence of ALT I. Although the expression level of ALT III was found to be much lower in most tissues and cells compared with that of PLCdelta 4, it was significantly higher in some neural cells, such as NIE-115 cells and p19 cells differentiated to neural cells by retinoic acid. Interestingly, recombinant ALT III protein did not retain enzymatic activity, and the activity of PLCdelta 4 overexpressed in COS7 cells was markedly decreased by the co-expression of ALT III but not by ALT I or II. Moreover, N-terminal pleckstrin homology domain (PH domain) of ALT III alone could inhibit the increase of inositol-1,4,5-trisphosphate levels in PLCdelta 4-overexpressing NIH3T3 cells, whereas a PH domain deletion mutant could not, indicating that the PH domain is necessary and sufficient for its inhibitory effect. The ALT III PH domain specifically bound to phosphatidylinositol (PtdIns)-4,5-P2 and PtdIns-3,4,5-P3 but not PtdIns, PtdIns-4-P, or inositol phosphates, and the mutant R36G, which retained only weak affinity for PtdIns-4,5-P2, could not inhibit the activity of PLCdelta 4. These results indicate that PtdIns-4,5-P2 binding to PH domain is essential for the inhibitory effect of ALT III. ALT III also inhibited PLCdelta 1 activity and partially suppressed PLCgamma 1 activity, but not PLCbeta 1 in vitro; it did inhibit all types of isozymes tested in vivo. Taken together, our results indicate that ALT III is a negative regulator of PLC that is most effective against the PLC delta -type isozymes, and its PH domain is essential for its function.

    INTRODUCTION
Top
Abstract
Introduction
References

Phospholipase C (PLC)1 plays a crucial role in the inositol phospholipid signaling by hydrolyzing phosphatidylinositol (PtdIns)-4,5-bisphosphate. This reaction produces two intracellular second messengers, inositol 1,4,5-trisphosphate (Ins-1,4,5-P3) and diacylglycerol, which cause the increase of intracellular calcium concentration and the activation of protein kinase C (PKC), respectively (1). These cascades are thought to be terminated by the dephosphorylation of Ins-1,4,5-P3 by inositol phosphate phosphatases (2) and the phosphorylation of diacylglycerol by diacylglycerol kinases (3). However, since two signals are generated simultaneously by one enzyme (an enzyme of PLC), there might be also a mechanism that turns off these cascades simultaneously, i.e. a negative regulation of PLC.

The PLC family is comprised of 10 subtypes found in mammalian species, and on the basis of their structure, they have been divided into three classes, beta  (beta 1-4), gamma  (gamma 1 and 2), and delta  (delta 1-4) types (4). Positive regulation mechanisms of PLC by association with membrane receptors are well characterized in beta - and gamma -type isozymes. beta -Type isozymes are activated by the Galpha or Gbeta gamma subunit released from heterotrimeric Galpha beta gamma proteins after ligand stimulation (4-7). gamma -Type isozymes are activated by the phosphorylation of specific tyrosine residues through the activation of receptor or nonreceptor tyrosine kinases (4, 8, 9). The mechanism by which delta -type isozymes are coupled to membrane receptors remains unclear.

Several recent studies indicate that the pleckstrin homology (PH) domains of PLC isozymes are also important for the activity of the isozymes. First, PLCdelta 1 was shown to be activated by the binding of PtdIns-4,5-P2 to its PH domain and inhibited by the binding of Ins-1,4,5-P3 to the same domain (10-12). On the basis of the information obtained from the three-dimensional structure of PLCdelta 1, a catalytic mechanism comprising two steps, tether and fix, was proposed (13); the PH domain tethers the enzyme to the membrane by specific binding to PtdIns-4,5-P2, and the C2 domain fixes the catalytic domain in a productive orientation on the membrane. Therefore, the PH domain plays a important role for the first contact to the plasma membrane. Second, more recent studies indicate that the PtdIns-3,4,5-P3 binding to the PH domain is involved in the protein tyrosine kinase-independent activation of PLCgamma 1. It has been reported that the overexpression of PtdIns-3 kinase, which produces PtdIns-3,4,5-P3, results in the activation of PLCgamma 1 by the binding of PtdIns-3,4,5-P3 to the N-terminal PH domain (14). Furthermore, SH2-containing inositol-5'-phosphatase, which removes 5'-phosphates from phosphoinositides, was shown to eliminate the PtdIns-3,4,5-P3-dependent activation of PLCgamma 1 in B cells, resulting in a decrease in Ins-1,4,5-P3 formation and decreased calcium mobilization (15, 16). Therefore, SH2-containing inositol-5'-phosphatase functions as a negative regulator of PLCgamma 1 by inhibiting PtdIns-3,4,5-P3-dependent activation, at least in B cells.

Negative regulations of PLC by protein kinase C (PKC) and cAMP-dependent protein kinase are also known (4, 17-21). The proposed targets for phosphorylation by these kinases include cell-surface receptors, G proteins, and PLC itself. cAMP-dependent protein kinase directly phosphorylates the serine residues of PLCbeta 2 and -beta 3 and inhibits the stimulation of their activity by Gbeta gamma or Galpha q, respectively (17, 18). PLCbeta 1 is phosphorylated by PKCalpha , resulting in the inhibition of its activation by Gbeta /gamma (21). It was also reported that gelsolin and profilin, which bind to PtdIns-4,5-P2, compete with PLC for PtdIns-4,5-P2, resulting in the inhibition of the activity of PLCbeta and -gamma , respectively (22, 23). However, the negative regulation mechanism of PLC delta -types remains unknown.

Here, we report that a novel spliced variant of PLCdelta 4, termed ALT III, functions as a negative regulator of PLC through its PH domain. ALT III inhibited the activity of PLCdelta most effectively among the PLC isozymes in vivo and in vitro. This is the first demonstration of a negative regulator of PLC delta -type isozymes.

    EXPERIMENTAL PROCEDURES

Materials

[3H]PtdIns-4,5-P2, [3H]Ins-1,4,5-P3, and [3H]Ins-1,3,4,5-P4 were obtained from NEN Life Science Products. Phosphatidylethanolamine, phosphatidylserine, phosphatidylcholine, and phosphatidylinositol (PtdIns) were from Doosan Sedary Research Laboratories, Ins-1,4,5-P3, Ins-1,3,4,5-P4, and bradykinin were from Sigma, and platelet-derived growth factor (PDGF) was from Boehringer Mannheim (Mannheim, Germany). PtdIns-4,5-P2 and PtdIns-4-P were purified from bovine spinal cords. PtdIns-3,4,5-P3 (both acyl groups are palmitoyl) was chemically synthesized. The transfected cell selection kit, the MACSelect4 and the MACS high-gradient magnetic separation columns were purchased from Miltenyl Biotec (Bergisch-Gladbach, Germany). The Ins-1,4,5-P3 assay kit was obtained from Amersham Pharmacia Biotech. The rabbit polyclonal anti-PLCdelta 4 antibody was raised against the C-terminal 157 amino acid-tagged 6xHis using the vector pQE-31. PLCbeta 1, -gamma 1, and -delta 1 were purified from bovine brain by using a three-step column chromatography technique (24).

Methods

Isolation of a Novel Spliced Variant of PLCdelta 4, Termed ALT III-- Total RNA was isolated from rat tissues by the guanidinium isothiocyanate method and from culture cells by the Nonidet P-40 method. A reverse transcription-polymerase chain reaction (RT-PCR) was carried out using rat testis total RNA as described previously (25). In brief, the entire coding region of PLCdelta 4 cDNA was amplified with two sets of primers, both of which corresponded to the 5'- or 3'-untranslated regions of the cDNA by two consecutive rounds of PCR. The second-round PCR products were subcloned into the vector pBluescript (KS-). The nucleotide sequences were determined by the autocycle sequencing method using a DSQ-1000 DNA sequencer (Shimadzu, Kyoto, Japan). Among these clones, two clones coding a novel splice variant of PLCdelta 4, termed ALT III, were identified.

Measurement of mRNA Level by RT-PCR-- To determine the tissue distribution of PLCdelta 4 isoforms, first strand cDNA was amplified with PLCdelta 4-specific primers (nucleotides 1187-1206 and 1658-1677) to produce 491- (PLCdelta 4), 587- (ALT I), 533- (ALT II), and 398-base pair (ALT III) fragments. PCR was performed for 24 cycles of 15 s at 94 °C, 15 s at 60 °C, and 30 s at 72 °C with 10 µCi of [alpha -32P]dCTP, and the products were detected by autoradiography. We confirmed that these products were linearly amplified during this cycle.

Immunoblotting-- Lysates from various tissues and cells were subjected to 7.5% SDS-polyacrylamide gel electrophoresis, and proteins were transferred to polyvinylidene difluoride membranes. The membranes were incubated with anti-PLCdelta 4 antibodies and stained with alkaline phosphatase-conjugated goat anti-rabbit IgG antibody. Alternatively, primary incubation using anti-PLCdelta 4 antibody was followed by the incubation in horseradish peroxidase-conjugated goat anti-rabbit IgG. Membranes were developed using an enhanced chemiluminescence system (ECL, Amersham Pharmacia Biotech) according to the method recommended by the manufacturer.

Cell Culture, Transfection, and Selection of Transfected Cells Using the MACSelect 4 Kit-- COS7, N1E-115, and Bosc23 cells were maintained in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% fetal bovine serum (FBS). NIH3T3 cells were maintained in DMEM with 10% calf serum. PC12 cells were maintained in DMEM with 10% horse serum and 5% FBS. C6 cells were maintained in Ham's F-10 nutrient medium (Life Technologies, Inc.) with 10% horse serum and 2.5% FBS. NG108-15 cells were maintained in DMEM supplemented with 10% FBS, 0.1 mM hypoxanthine, 1 µM aminopterin, and 16 µM thymidine. p19 cells were maintained in alpha -minimal essential medium with 10% FBS. The induction of the differentiation of p19 cells with retinoic acid was performed as described previously (26). NG108-15 and p19 cells were kindly provided by Dr. T. Michikawa (University of Tokyo). PLCdelta 4, ALT I, II, and III were subcloned into the expression vector pcDNA3 (kindly provided from Dr. F. Shibasaki (Tokyo Metropolitan Institute of Medical Science)). The pMACS4 vector carrying cDNA of CD4 was co-transfected with pcDNA3 carrying cDNAs encoding PLCdelta 4, ALT I, II, and III in COS7 cells. Transfections were performed by electroporation (Bio-Rad). The cells were incubated at 37 °C for 2 days and harvested. The cells were then applied on the MACS high gradient magnetic separation columns to collect the cells expressing CD4 protein, and after 3 washes, the cells bound to the column were eluted according to the manufacturer's protocol. Lysates from the harvested cells were then used for the PLC assay.

Retrovirus Expression-- The retrovirus vector, pMx, was kindly provided by Dr. T. Kitamura (University of Tokyo). cDNAs of PLCdelta 4, ALT III, and ALT III PH (nucleotides 1-376), Delta PH domain (nucleotides 202-3'-end), and PLCdelta 1 were subcloned into this vector. Recombinant retroviruses were generated and infected to NIH3T3 cells as described (27). In brief, cDNAs of interest were transfected in Bosc23 cells, in which the recombinant retrovirus is produced, and the cells were incubated for 2 days. The supernatant of the cells that contained the recombinant virus was then collected, and exponentially growing NIH3T3 cells were infected in the virus solutions for 2 days. After that, the cells were harvested. Alternatively, cells were further incubated in starvation medium (DMEM supplemented with insulin/transferrin/sodium selenite supplement (ITS) and bovine albumin serum (Boehringer Mannheim)) for 24 h, stimulated by 1 µM bradykinin or 50 ng/ml PDGF for the indicated time (see figure legends) and harvested. Cells infected with the recombinant viruses containing cDNA of green fluorescent protein were used as the control.

Purification of PLCdelta 4 and ALT III Protein Generated by an Sf9/Baculovirus Expression System-- Recombinant PLCdelta 4 and ALT III proteins were prepared using a baculovirus expression system. cDNA of PLCdelta 4 and ALT III was subcloned into the vector pFastbac (Life Technologies, Inc.). Recombinant, clonal baculoviruses were generated according to the protocol described by Life Technologies, Inc. Sf9 cells were grown at 28 °C in Sf-900 II SFM (Life Technologies, Inc.) containing 10% FBS. Baculoviruses were used to infect at a density of 1 × 106 cells/ml. The proteins were purified according a method described previously (25).

Measurement of PLC Activity-- PLC activity was assayed with [3H]PtdIns-4,5-P2 as the substrate. The PtdIns-4,5-P2-hydrolyzing activity was measured with mixed phospholipid micelles containing 40 µM phosphatidylethanolamine, 5 µM PtdIns-4,5-P2, and 1 µCi/ml [3H]PtdIns-4,5-P2. The lipids in chloroform were dried under a steam of nitrogen gas, suspended in assay buffer (20 mM HEPES, pH 7.0, 120 mM NaCl, 2 mM MgCl2, 40 or 100 µM CaCl2, and 1 mg/ml bovine albumin serum (Bayer, Leverkusen, Germany)), and subjected to sonication. All proteins added to the reaction mixture were dialyzed overnight against the assay buffer. Incubation was performed for 10 min at 37 °C in a 50-µl reaction mixture containing lipid micelles (5 µM [3H]PtdIns-4,5-P2, 20,000 dpm). The reaction was stopped by adding 2 ml of chloroform:methanol (2:1, v/v). Inositol trisphosphates were extracted with 0.5 ml of 1 N HCl, and the radioactivities in the upper aqueous phase were measured.

Assay of [3H]PtdIns-4,5-P2 Binding to the ALT III PH Domain-- Recombinant glutathione S-transferase (GST) fusion proteins containing the ALT III PH domain (nucleotides 1-860) and R36G ALT III PH were constructed. Site-directed mutagenesis by a two-stage PCR method was performed as described (28). These proteins were expressed in Escherichia coli, and the lysates were mixed with glutathione-Sepharose beads. After three washes, proteins were eluted and dialyzed overnight against binding buffer (20 mM HEPES, 120 mM NaCl, 2 mM MgCl2, pH 7.4). Purified fusion proteins were mixed with micelles containing 2 µM [3H]PtdIns-4,5-P2, 20,000 dpm, 6 µM phosphatidylserine, and 18 µM phosphatidylcholine in 50 µl of the binding buffer for 1 h at room temperature. Then 50 µl of glutathione-Sepharose beads were added, and the tubes were incubated for 15 min at room temperature with occasionally mixing. The tubes were centrifuged at 2,000 rpm for 2 min, and the radioactivity bound to beads was then measured.

Assay of Inositol Phosphate Binding-- Recombinant GST fusion proteins containing the ALT III PH domain or PLCdelta 1 PH domain (nucleotides 1-880) were expressed in E. coli and purified. Ins-1,4,5-P3 and Ins-1,3,4,5-P4 binding assays using [3H]Ins-1,4,5-P3 and [3H]Ins-1,3,4,5-P4 were performed as described elsewhere (29).

Measurement of Ins-1,4,5-P3 Level-- Ins-1,4,5-P3 levels were assayed using a commercial Ins1,4,5-P3 assay kit (Amersham Pharmacia Biotech) according to the manufacturer's protocol.

    RESULTS

Isolation of ALT III, a Novel Alternatively Spliced Variant of PLCdelta 4-- PLCdelta 4 is an enzyme that is inducible in response to mitogenic stimuli, and its expression is restricted in several tissues and cells (30). In addition to such characters, two alternatively spliced variants of PLCdelta 4, termed ALT I and ALT II, are also known to exist (25). To understand the specific function of PLCdelta 4 and the mechanisms of its regulation, we tried to obtain another isoform of PLCdelta 4. The entire coding region of PLCdelta 4 cDNA was amplified by RT-PCR as described by Lee and Rhee (25), subcloned into the vector pBluescript KS(-), and sequenced. The complete sequence of these products revealed that a novel splice variant termed ALT III could be obtained in addition to the reported isoforms, including PLCdelta 4, ALT I, and ALT II. In ALT III, 63 amino acids containing the C-terminal of the catalytic X domain and linker region between the catalytic X and Y domains were substituted for 32 amino acids corresponding to the insert sequence of ALT I (Fig. 1A). ALT III protein was highly expressed in some neural cells (Fig. 2C), indicating that it exists in living cells and is not an artifact obtained by PCR. An analysis of the genomic DNA sequence of PLCdelta 4 revealed that PLCdelta 4, ALT I, II, and III were generated from a single gene by alternative splicings.2 ALT I and II mRNA are comprised of exons IX, X, XI and new exons X' or X" between exons X and XI of the gene, respectively. A splicing donor site for the exon X was not recognized in ALT III, and ALT III is comprised of exons IX, XI, and a new exon, X'. Thus, ALT III contains amino acids VMKCPMSCLLICVHVLAQAPNSIPESILLPKR instead of the region from 424 to 486 (Fig. 1B).


View larger version (29K):
[in this window]
[in a new window]
 
Fig. 1.   Splicing isoforms of phospholipase Cdelta 4. A, schematic representation of PLCdelta 4 splicing isoforms. A PLCdelta 4 gene produces four isoforms, PLCdelta 4, ALT I, II, and III. ALT I and II contains 32 and 14 additional amino acids in their respective sequences in the linker region between the catalytic X and Y domains, whereas in the case of ALT III, 63 amino acids containing the C-terminal of the X domain and linker region (424-486, the numbers denote the positions of the peptide sequence) were substituted for 32 amino acids corresponding to the insert sequence of ALT I. B, schematic representation of PLCdelta 4 genomic structure in the region at which splice differences occurred. Exons of PLCdelta 4 are indicated as IX, X, X', X", and XI. ALT I and II contain an additional new exon, X' or X", respectively. ALT III also contains exon X' but does not possess exon X.


View larger version (34K):
[in this window]
[in a new window]
 
Fig. 2.   Distribution of PLCdelta 4 isoforms. A, immunoblotting analysis of lysates from rat tissues with anti-PLCdelta 4 antibodies. Lane 1, brain; lane 2, testis; lane 3, thymus; lane 4, heart; lane 5, lung; lane 6, spleen; lane 7, liver; lane 8, kidney; lane 9, intestine. B, RT-PCR analysis of PLCdelta 4 total RNA from rat tissues with PLCdelta 4-specific primers. Lane 1, brain; lane 2, thymus; lane 3, heart; lane 4, lung; lane 5, spleen; lane 6, liver; lane 7, kidney; lane 8, intestine; lane 9, testis; lane 10, negative control (-template). C, immunoblotting analysis of lysates from various neural culture cells with anti-PLCdelta 4 antibodies. Lane 1, brain; lane 2, glia; lane 3, C6, rat glioblastoma cells; lane 4, N1E-115, mouse neuroblastoma cells; lane 5, PC12, rat pheochromocytoma cells; lane 6, NG108-15, mouse neuroblastoma cells; lane 7, p19, mouse embryonal carcinoma cells; lane 8, p19 differentiated to neural cells by retinoic acid (5 × 10-7 M).

Distribution of PLCdelta 4 Isoforms in Tissues and Cells-- We next examined the distribution of PLCdelta 4 isoforms in rat tissues and culture cells. Lysates from rat tissues and culture cells were subjected to an immunoblot analysis with affinity purified polyclonal antibodies to PLCdelta 4 (Fig. 2, A and C). The expressions of PLCdelta 4 isoforms mRNA were also examined by RT-PCR with a pair of PLCdelta 4-specific primers (Fig. 2B). Both analyses indicated that PLCdelta 4 was expressed in the brain and testis, and weak signals were observed in the heart and lung. The expressions of ALT I and II were abundant in the testis. A strong signal for ALT III was detected by immunoblotting in the heart. Some differences between the results of the RT-PCR and those of the immunoblotting were observed. For instance, although the expression of PLCdelta 4 mRNA was detected by RT-PCR in the spleen and kidney, the proteins were not detected. Also, ALT II and III proteins were detected by immunoblotting in the liver, and PLCdelta 4 protein was detected in the thymus, but the respective mRNAs were not detected. Although the ALT III expression was at quite a lower level compared with that of PLCdelta 4 in most tissues and cells, it was abundant in NIE-115 cells (a mouse neuroblastoma cell line) and p19 cells differentiated to neural cells by 5 × 10-7 M retinoic acid (Fig. 2C). In C6 cells, a rat glioblastoma cell line, PLCdelta 4, and ALT III were quite rich. We also detected PLCdelta 4 and ALT III mRNA in these cell lines by RT-PCR (data not shown). It was noteworthy that the expression level of ALT III was significantly higher in differentiated neural p19 cells compared with that in undifferentiated embryonic p19 cells.

Inhibition of PLCdelta 4 Activity by ALT III Caused by the PH Domain-- Since ALT III lacks a part of the X domain and almost the entire linker region, we expected that ALT III would not retain enzymatic activity. To investigate this, we subcloned the full-length of all PLCdelta 4 isoforms into the vector pcDNA3, and the encoded genes were co-expressed with the vector carrying CD4 gene in COS7 cells. Transfected cells were separated by magnetic beads to collect the cells expressing CD4 protein. At least 30% of the cells expressing CD4 protein were co-transfected with PLCdelta 4 (data not shown). Therefore, PLCdelta 4-overexpressing cells were concentrated enough to detect the activity of PLCdelta 4 in their lysates. Fig. 3A shows that PLCdelta 4 and ALT II retained their activity up to 2.7- and 2.8-fold, respectively, compared with the control, whereas the activity of ALT I only reached approximately 1.5-fold. ALT III does not have PLC activity at all. We also confirmed that recombinant ALT III protein generated by the Sf9/baculovirus system did not retain PLC activity (data not shown). Moreover, the activity of PLCdelta 4 was markedly decreased by the co-expression of ALT III, to less than 40%, but not by ALT I (Fig. 3B). On the other hand, ALT II is catalytically as active as PLCdelta 4, but PLCdelta 4 activity was rather suppressed by the co-expression of ALT II, slightly (Fig. 3B). We do not know why it happened. However, we confirmed that the activity of recombinant PLCdelta 4 protein was not inhibited by the addition of the recombinant ALT II protein generated by Sf9/baculovirus system (data not shown). Therefore, this partial suppression by ALT II may be caused by some factors that affect the function of ALT II in vivo.


View larger version (25K):
[in this window]
[in a new window]
 
Fig. 3.   Enzymatic activity of PLCdelta 4 was inhibited by ALT III, and the PH domain was necessary and sufficient for its inhibitory effect. A, activity of PLCdelta 4 isoforms. PLCdelta 4 isoforms were co-expressed with a vector carrying the CD4 gene in COS7 cells. Transfected cells were separated by magnetic beads that could harvest the cells expressing CD4 protein. cDNA of CD4 alone was also overexpressed, and transfected cells were separated and used for the control. PLC assays were performed using their lysates, and the PLC activity is presented as the fold increase against control lysates. B, enzymatic activity of PLCdelta 4 was inhibited by the co-expression of ALT III but not by ALT I or II. PLCdelta 4 splicing isoforms were co-expressed with PLCdelta 4 and CD4, and lysates from transfected cells harvested by magnetic beads were used for the PLC assay. Data represent inhibition (%) against PLCdelta 4-overexpressing cell lysates. C, the PH domain alone could inhibit the activity of PLCdelta 4, whereas the PH domain deletion mutant could not. Various constructs (indicated in the figure) were overexpressed by a retrovirus expression system in NIH3T3 cells, and Ins-1,4,5-P3 levels were measured with an assay kit. Data represent inhibition (%) against Ins-1,4,5-P3 levels in PLCdelta 4-overexpressing cells. All data are means ± S.E.(n = 4).

In order to clarify how PLCdelta 4 is inhibited by ALT III in vivo, we next investigated whether the PH domain alone or the PH domain deletion mutant of ALT III could inhibit the activity of PLCdelta 4. PLCdelta 4, ALT III, the PH domain coding region, and PH domain deletion mutant cDNAs were expressed by a retrovirus system in NIH3T3 cells. The cells expressing various constructs were then harvested, and the Ins-1,4,5-P3 level was measured. As a result, ALT III did not retain enzymatic activity and inhibited the activity of PLCdelta 4 in vivo (Fig. 3C). Moreover, the ALT III PH domain alone could completely block the activity of PLCdelta 4, whereas the PH domain deletion mutant could not (Fig. 3C). These results indicate that the ALT III PH domain is necessary and sufficient for its inhibitory effect.

The ALT III PH domain specifically binds to PtdIns-4,5-P2 and PtdIns-3,4,5-P3 but not PtdIns, PtdIns-4-P, or inositol phosphates-- We then analyzed the binding of inositol phospholipid to the ALT III PH domain. A recombinant GST fusion protein containing the ALT III PH domain and the mutant R36G were expressed in E. coli and purified, and an inositol phospholipid binding assay was performed. Since Arg-36 of ALT III corresponds to Arg-40 of PLCdelta 1, which is essential for the Ins-1,4,5-P3 binding and catalytic activity of PLCdelta 1 (31), we constructed the R36G mutant as a mutant that could not bind to PtdIns-4,5-P2. The ALT III PH domain bound to PtdIns-4,5-P2 in phospholipid vesicles in a dose-dependent manner (Kd = 5.8 µM) (Fig. 4A and data not shown). Since the PLCdelta 1 PH domain bound to PtdIns-4,5-P2 (Kd = 3.4 µM) in our system (data not shown), the affinity of the ALT III PH domain to PtdIns-4,5-P2 was comparable to that of the PLCdelta 1 PH domain. Unexpectedly, the R36G mutant could also bind to PtdIns-4,5-P2 with quite low affinity. Next, to determine the binding specificity of the ALT III PH domain to inositol phospholipid, we examined the competitive effect of various unlabeled inositol phospholipids on the binding of [3H]PtdIns-4,5-P2 to the PH domain. We found that the binding of [3H]PtdIns-4,5-P2 was inhibited to 60% by the addition of a 10-fold excess amount of unlabeled PtdIns-4,5-P2 and to 50% by PtdIns-3,4,5-P3, but not PtdIns or PtdIns-4-P, in a dose-dependent manner (Fig. 4B), showing that the ALT III PH domain has strong binding affinity for PtdIns-4,5-P2 and PtdIns-3,4,5-P3. We also examined the binding of the ALT III PH domain to inositol phosphates. Interestingly, the ALT III PH domain did not bind to Ins-1,4,5-P3 or Ins-1,3,4,5-P4 at all (Fig. 4, C and D).


View larger version (12K):
[in this window]
[in a new window]
 
Fig. 4.   Binding of the ALT III PH domain to inositol phospholipids and inositol phosphates. A, binding of PtdIns-4,5-P2 to the ALT III PH domain and the mutant R36G. Recombinant GST fusion proteins were expressed in E. coli. Eluted proteins were mixed with various amounts of [3H]PtdIns-4,5-P2, and then glutathione-Sepharose beads were added to the reaction mixture. After centrifugation, radioactivities bound to beads were measured. B, binding specificity of the ALT III PH domain to inositol phospholipids. Binding assays of the ALT III PH domain were performed with 100 pmol of [3H]PtdIns-4,5-P2 in the presence of various amounts of competitive inhibitors. The concentrations of competitive unlabeled lipids are indicated as the relative molar ratio of [3H]PtdIns-4,5-P2. C and D, binding of the ALT III PH domain to Ins-1,4,5-P3 and Ins-1,3,4,5-P4. Recombinant GST fusion proteins containing the PLCdelta 1 PH domain or ALT III PH domain were mixed and incubated on ice in the presence of various amounts of [3H]Ins-1,4,5-P3 and [3H]Ins-1,3,4,5-P4. Ins-1,4,5-P3 and Ins-1,3,4,5-P4 binding were determined by the method of polyethylene glycol precipitation (33). Data represent duplicate determinations in one of two experiments; error bars give the range of duplicates.

Inhibitory Effect of ALT III on PLC Activity in Vitro-- To investigate the importance of the PH domain for the inhibitory effect of ALT III on PLC activity in vitro, the activities of recombinant PLCdelta 4 protein generated by the Sf9/baculovirus system were measured in the presence of recombinant ALT III protein generated by the Sf9/baculovirus system, and the PH domain, X-Y domain, and R36G mutant proteins generated by the bacteria system. As in the in vivo experiments (Fig. 3C), the activity of recombinant PLCdelta 4 protein was inhibited to 70% by the addition of equal amounts of ALT III and PH domain protein and to 40 and 55% by 2-fold excess amounts of ALT III and PH domain proteins, respectively (Fig. 5A). The activity of PLCdelta 4 was suppressed by a 2-fold excess amount of X-Y domain protein. The mutant R36G, of which the potency for PtdIns-4,5-P2 binding is markedly reduced, did not inhibit the activity at all, indicating that PtdIns-4,5-P2 binding to PH domain is essential for the inhibitory effect of ALT III. Next, we investigated the effect of ALT III protein on the other PLC activities, such as PLCbeta 1, -gamma 1, and -delta 1 purified from bovine brain. As shown in Fig. 5B, ALT III inhibited the activity of PLCdelta 1 most effectively. The activity of PLCgamma 1 was partially suppressed, and PLCbeta 1 was not affected at all. It is difficult to compare the sensitivity of PLCdelta 1 and that of PLCdelta 4, because the sources of the proteins are different, i.e. PLCdelta 1 is purified from bovine brain whereas PLCdelta 4 is a recombinant protein. However, at least these data show that ALT III is more effective against PLCdelta -type isozymes than PLCbeta 1 and -gamma 1 in vitro.


View larger version (18K):
[in this window]
[in a new window]
 
Fig. 5.   Inhibitory effect of ALT III in vitro. A, effect of various constructs of ALT III on the activity of PLCdelta 4. PLC assays were performed as described under "Experimental Procedures" in the presence of various amounts of ALT III generated by the Sf9/baculovirus system and GST fusion proteins containing the ALT III PH domain, ALT III X-Y domain (nucleotides 202-1844), and R36G mutant generated by bacteria system. The amounts of proteins are indicated as the molar ratio against PLCdelta 4 protein. B, effect of ALT III on the activity of PLCbeta 1, -gamma 1, and -delta 1 in vitro. The activity of purified PLCbeta 1, -gamma 1, and -delta 1 was assayed in the presence of various amounts of recombinant ALT III protein in vitro. The amounts of ALT III protein are indicated as the molar ratio against each PLC isozymes. Data represent duplicate determinations in one of two experiments; error bars give the range of duplicates.

The Suppression of Ins-1,4,5-P3 Production by ALT III in Vivo-- To determine which PLC isozymes were inhibited by ALT III in vivo, we next investigated whether the overexpression of ALT III in NIH3T3 cells affects the Ins-1,4,5-P3 production generated by the stimulation of bradykinin, PDGF, or the overexpression of PLCdelta 1. As shown in Fig. 6, A and B, in contrast to the results of the present in vitro experiments, the PLC activities stimulated by bradykinin and PDGF were inhibited by ALT III, although it was demonstrated that bradykinin and PDGF activate mainly PLCbeta 1 and PLCgamma 1, respectively. Moreover, the increase in the production of Ins-1,4,5-P3 by the overexpression of PLCdelta 1 in NIH3T3 cells reverted to the control level by the co-expression with ALT III (Fig. 6C), indicating that the activity of PLCdelta 1 is inhibited by ALT III in vitro and in vivo.


View larger version (19K):
[in this window]
[in a new window]
 
Fig. 6.   ALT III effectively inhibited the activity of PLCdelta 1 and suppressed the activity of PLCbeta and -gamma in vivo. A-C, effects of ALT III on the activities of PLCbeta , -gamma , and -delta 1 in vivo. ALT III was overexpressed using a retrovirus expression system in NIH3T3 cells, and then the cells were serum-starved in starvation medium for 24 h, stimulated by bradykinin (1 µM) (A) or PDGF (50 ng/ml) (B) for the indicated times, and harvested. The Ins-1,4,5-P3 level was measured with an Ins-1,4,5-P3 assay kit. C, PLCdelta 1 was co-expressed with ALT III. Data represent duplicate determinations in one of two experiments; error bars give the range of duplicates.


    DISCUSSION

We demonstrated that a novel alternatively spliced variant of PLCdelta 4 acts as a negative regulator of PLC isozymes. Although some of the genes that encode PLC isozymes are also known to produce splice variants, such as norpA (32) and plc21 (33), both of which encode phospholipase C in Drosophila, PLCbeta 1 (34) and -beta 4 (35), all of their splicing differences occur outside of the catalytic X and Y domains. Therefore, ALT III is the first example of a splice variant in which the difference occurs inside the catalytic domain. Although the expression level of ALT III was quite lower than that of PLCdelta 4 in most of the tissues and cells examined, it was significantly higher in N1E-115 cells, a rat neuroblastoma cell line (Fig. 2). Remarkably, p19 cells, a rat embryonal carcinoma cell line, normally expressed ALT III at a low level, but the expression was higher compared with that of PLCdelta 4 when p19 cells were differentiated to neural cells by retinoic acid (Fig. 2C). These results suggest that ALT III is expressed and functions specifically in some neural cells.

Since ALT III lacks the C-terminal of the X domain and linker region, we first studied whether this molecule had PLC activity; we found that it does not (Fig. 3A). We next examined the biological functions of this molecule, since it is presumed that ALT III inhibits PLC isozymes by competition for PtdIns-4,5-P2. As shown in this report, ALT III inhibited the activity of PLCdelta 4 and -delta 1 in vitro and in vivo and PLCbeta and -gamma in vivo (Figs. 3, 5, and 6). Unexpectedly, the overexpression of ALT III did not result in the inhibition of endogenous PLC activity in unstimulated control cells (Fig. 3, A and C). Since the PLC activity in the control cells was not so high without agonist stimulation, it may be not sensitive to ALT III. Besides, the ALT III PH domain alone inhibited the PLC activity, whereas the PH domain deletion mutant did not (Figs. 3C and 5A). These results indicate that ALT III is a negative regulator of PLC delta -type isozymes and that the PH domain is necessary and sufficient for the inhibitory effect. Furthermore, since the mutant R36G, the binding potency to PtdIns-4,5-P2 of which is very low, did not inhibit the activity of PLCdelta 4 (Fig. 5A), PtdIns-4,5-P2 binding to the ALT III PH domain, resulting in the competition for PtdIns-4,5-P2 with the other PLCs, is essential for the inhibition by ALT III.

Different PH domains have different binding specificities for various inositol phospholipids and are divided into four groups based on their selectivities (36, 37). The first group is the PH domains that bind to PtdIns-3,4,5-P3 with high affinity rather than to PtdIns-4,5-P2, such as the PH domains of Bruton's tyrosine kinase-1, general receptor for phosphoinositides-1, N-terminal T lymphoma invasion and metastasis protein-1, and son of sevenless-1. The second group is the PH domains that bind to PtdIns-4,5-P2 with high affinity and to PtdIns-3,4,5-P3 with relatively weak or the same affinity, such as those of PLCdelta 1, beta -adrenergic receptor kinase, spectrin, and oxysterol-binding protein-1. The third group of PH domains bind specifically to PtdIns-3,4-P2, including that of Akt/protein kinase B. The fourth group of PH domains bind with low affinity and no selectivity to inositol phospholipids. In regard to the PLC PH domain, PLCdelta 1 belongs to the second group with high affinity for PtdIns-4,5-P2 (11, 38-40), whereas the PLCgamma 1 PH domain would be in the first group with high affinity for PtdIns-3,4,5-P3 (14, 15). Since the PLCbeta 1 PH domain is known to bind lipids nonspecifically (39), it might belong to the fourth group.

Our present results showed that the ALT III PH domain can specifically bind to PtdIns-4,5-P2 and PtdIns-3,4,5-P3 but not PtdIns or PtdIns-4-P (Fig. 4B), suggesting that the ALT III PH domain belongs to the second group, to which the PLCdelta 1 PH domain belongs. Interestingly, despite the sequence similarity of ALT III PH domain with the PLCdelta 1 PH domain which binds to PtdIns-4,5-P2 and Ins-1,4,5-P3 with high affinity, the ALT III PH domain could not bind to Ins-1,4,5-P3 or Ins-1,3,4,5-P4 (Fig. 4, C and D). One possible reason is that the binding of the ALT III PH domain to PtdIns-4,5-P2 and PtdIns-3,4,5-P3 is required for additional contact with a hydrophobic region such as the acyl chain of lipids. This explanation is not inconsistent with our finding that the R36G mutant still bound to PtdIns-4,5-P2 with low affinity. In fact, some of the proteins, such as Bruton's tyrosine kinase, bind to inositol phospholipid with higher affinity than to inositol phosphate, and it is considered that the natural ligand of such protein is the lipid rather than the inositol phosphate (37).

Our results showed that ALT III inhibited the activity of PLC delta -types the most efficiently and were less effective against PLCbeta 1 and -gamma 1 (Fig. 5B) in vitro. The different effects on PLC isozymes imply that the inhibition is not caused by the simple competition for PtdIns-4,5-P2 as a substrate with the PLC. It is known that the activity of PLCdelta 1 is activated by the binding of PtdIns-4,5-P2 to its PH domain (10), but PLCbeta 1 and -gamma 1 are not known to be activated by PtdIns-4,5-P2 (39, 41). Therefore, PLCdelta 1 needs more PtdIns-4,5-P2 than the other isozymes for binding to the PH domain and for a substrate, whereas PLCbeta 1 and -gamma 1 need PtdIns-4,5-P2 only as a substrate. The specificities of the inhibitory effect on PLCdelta 1 are reflected by the specificities of the binding affinity of its PH domain for PtdIns-4,5-P2. Therefore, the competitive binding of ALT III to PtdIns-4,5-P2 may cause the inhibition of PLCdelta 1 activation which is induced through the binding of PtdIns-4,5-P2 to its PH domain, i.e. the feature of PLCdelta 1 that is activated through the binding of PtdIns-4,5-P2 to its PH domain may cause the sensitivity to ALT III. In contrast, the low sensitivity of PLCbeta 1 and -gamma 1 to ALT III are reflected by their activation mechanism which is independent of the additional binding of PtdIns-4,5-P2 and may be caused by no specificity of their PH domain binding to PtdIns-4,5-P2. Alternatively, PLCbeta 1 and -gamma 1 may hydrolyze PtdIns-4,5-P2 bound to ALT III, whereas PLCdelta 1 and PLCdelta 4 may not do so in vitro.

In contrast to the results of the present in vitro experiments, the overexpression of ALT III suppressed the activity of PLCbeta and -gamma in vivo (Fig. 6, A and B), and the increase in the intracellular calcium concentration stimulated by bradykinin was also suppressed (data not shown). Unfortunately, since the level of the transient calcium increase stimulated by PDGF was not enough high to analyze the inhibitory effect of ALT III, we do not know whether ALT III could suppress it or not. However, the Ins-1,4,5-P3 production stimulated by PDGF was suppressed more efficiently than was that stimulated by bradykinin (Fig. 6, A and B), indicating that ALT III is more effective against PLCgamma than PLCbeta in vivo. Since the activities of PLCbeta 1 and -gamma 1 were not suppressed by ALT III in vitro, we do not think that ALT III inhibits their activity directly. One possible explanation for the suppression in vivo is that PLCbeta and -gamma are suppressed by ALT III indirectly, i.e. competition for PtdIns-4,5-P2 with the other membrane targeting molecules that affect the PLCbeta and -gamma activity causes the suppression of them by ALT III in vivo. However, in the case of PLCgamma , there still remains a possibility that competitive binding of ALT III to PtdIns-3,4,5-P3 causes the direct inhibition of PLCgamma activation which is induced through binding of PtdIns-3,4,5-P3 to its PH domain. Thus, the suppressions of PLCbeta and -gamma by ALT III in vivo are meaningful events in the physiological condition and may be suppressed not directly but indirectly, and specific targets for the direct inhibition by ALT III are thought to be PLCdelta -type isozymes.

    ACKNOWLEDGEMENTS

We thank Dr. T. Kitamura for providing the retrovirus vector; Dr. F. Shibasaki for pcDNA3 vector; Dr. T. Michikawa for NG108-15 and p19 cells; Maiko Fukuoka for important contributions to isolating mRNA and proteins from rat tissues; Kyoko Takahashi for purifying PLCbeta 1, -gamma 1, and -delta 1.

    FOOTNOTES

* The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

To whom correspondence should be addressed: Dept. of Biochemistry, Institute of Medical Science, University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639, Japan. Tel.: 81-3-5449-5510; Fax: 81-3-5449-5417; E-mail: takenawa{at}ims.u-tokyo.ac.jp.

The abbreviations used are: PLC, phospholipase C; PtdIns, phosphatidylinositol; Ins, inositol; PH, pleckstrin homology; PDGF, platelet-derived growth factor; RT-PCR, reverse transcription-polymerase chain reaction; GST, glutathione S-transferase; FBS, fetal bovine serum; DMEM, Dulbecco's modified Eagle's medium.

2 K. Fukami, K. Takenaka, A. Ito, K. Nagano, and T. Takenawa, submitted for publication.

    REFERENCES
Top
Abstract
Introduction
References

  1. Majerus, P. W. (1992) Annu. Rev. Biochem. 61, 225-250[CrossRef][Medline] [Order article via Infotrieve]
  2. Sims, C. E., and Allbritton, N. L. (1998) J. Biol. Chem. 273, 4052-4058[Abstract/Free Full Text]
  3. Hodgkin, M. N., Pettitt, T. R., Martin, A., Michell, R. H., Pemberton, A. J., and Wakelam, M. J. O. (1998) Trends Biochem. Sci. 23, 200-204[CrossRef][Medline] [Order article via Infotrieve]
  4. Rhee, S. G., and Bae, Y. S. (1997) J. Biol. Chem. 272, 15045-15048[Free Full Text]
  5. Jiang, H., Wu, D., and Simon, M. I. (1994) J. Biol. Chem. 269, 7593-7596[Abstract/Free Full Text]
  6. Camps, M., Carozzi, A., Schnabel, P., Scheer, A., Parker, P. J., and Gierschik, P. (1992) Nature 360, 684-689[CrossRef][Medline] [Order article via Infotrieve]
  7. Smrcka, A. V., and Sternweis, P. C. (1993) J. Biol. Chem. 268, 9667-9674[Abstract/Free Full Text]
  8. Margolis, B., Rhee, S. G., Felder, S., Mervic, M., Lyall, R., Levitzki, A., Ullrich, A., Zilberstein, A., and Schlessinger, J. (1989) Cell 57, 1101-1107[CrossRef][Medline] [Order article via Infotrieve]
  9. Meisenhelder, J., Suh, P. G., Rhee, S. G., and Hunter, T. (1989) Cell 57, 1109-1122[CrossRef][Medline] [Order article via Infotrieve]
  10. Lomasney, J. W., Cheng, H. F., Wang, L. P., Kuan, Y. S., Liu, S. M., Fesik, S. W., and King, K. (1996) J. Biol. Chem. 271, 25316-25326[Abstract/Free Full Text]
  11. Garcia, P., Gupta, R., Shah, S., Morris, A. J., Rudge, S. A., Scarlata, S., Petrova, V., McLaughlin, S., and Rebecchi, M. J. (1995) Biochemistry 34, 16228-16234[CrossRef][Medline] [Order article via Infotrieve]
  12. Paterson, H. F., Savopoulos, J. W., Perisic, O., Cheung, R., Ellis, M. V., Williams, R. L., and Katan, M. (1995) Biochem. J. 312, 661-666
  13. Essen, L. O., Perisic, O., Cheung, R., Katan, M., and Williams, R. L. (1996) Nature 380, 595-602[CrossRef][Medline] [Order article via Infotrieve]
  14. Falasca, M., Logan, S. K., Lehto, V. P., Baccante, G., Lemmon, M. A., and Schlessinger, J. (1998) EMBO. J. 17, 414-422[CrossRef][Medline] [Order article via Infotrieve]
  15. Scharenberg, A. M., EI-, Hillal, O., Fruman, D. A., Beitz, L. O., Li, Z., Lin, S., Gout, I., Cantley, L. C., Rawlings, D. J., and Kinet, J. P. (1998) EMBO. J. 17, 1961-1972[CrossRef][Medline] [Order article via Infotrieve]
  16. Scharenberg, A. M., and Kinet, J. P. (1998) Cell 94, 5-8[CrossRef][Medline] [Order article via Infotrieve]
  17. Liu, M., and Simon, M. I. (1996) Nature 382, 83-87[CrossRef][Medline] [Order article via Infotrieve]
  18. Yue, C., Dodge, K. L., Weber, G., and Sanborn, B. M. (1998) J. Biol. Chem. 273, 18023-18027[Abstract/Free Full Text]
  19. Kennedy, C. R. J., Proulx, P. R., and Hebert, R. L. (1995) Biochim. Biophys. Acta 1258, 206-214[Medline] [Order article via Infotrieve]
  20. Ali, H., Fisher, I., Haribabu, B., Richardson, R. M., and Snyderman, R. (1997) J. Biol. Chem. 272, 11706-11709[Abstract/Free Full Text]
  21. Litosch, I. (1997) Biochem. J. 326, 701-707
  22. Sun, H. Q., Lin, K. M., and Yin, H. L. (1997) J. Cell Biol. 138, 811-820[Abstract/Free Full Text]
  23. Goldschmidt-Clermont, P. J., Kim, J. W., Machesky, L. M., Rhee, S. G., and Pollard, T. D. (1991) Science 251, 1231-1233[Abstract/Free Full Text]
  24. Homma, Y., Emori, Y., Shibasaki, F., Suzuki, K., and Takenawa, T. (1990) Biochem. J. 269, 13-18[Medline] [Order article via Infotrieve]
  25. Lee, S. B., and Rhee, S. G. (1996) J. Biol. Chem. 271, 25-31[Abstract/Free Full Text]
  26. Edwards, M. K., and McBurney, M. W. (1983) Dev. Biol. 98, 187-191[CrossRef][Medline] [Order article via Infotrieve]
  27. Kitamura, T., Onishi, M., Kinoshita, S., Shibuya, A., Miyajima, A., and Nolan, G. P. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 9146-9150[Abstract/Free Full Text]
  28. Cheng, H. F., Jiang, M. J., Chen, C. L., Liu, S. M., Wong, L. P., Lomasney, J. W., and King, K. (1995) J. Biol. Chem. 270, 5495-5505[Abstract/Free Full Text]
  29. Takeuchi, H., Kanematsu, T., Misumi, Y., Yaakob, H. B., Yagisawa, H., Ikehara, Y., Watanabe, Y., Tan, Z., Shears, S. B., and Hirata, M. (1996) Biochem. J. 318, 561-568
  30. Liu, N., Fukami, K., Yu, H., and Takenawa, T. (1996) J. Biol. Chem. 271, 355-360[Abstract/Free Full Text]
  31. Yagisawa, H., Sakuma, K., Paterson, H. F., Cheung, R., Allen, V., Hirata, H., Watanabe, Y., Hirata, M., Williams, R. L., and Katan, M. (1998) J. Biol. Chem. 273, 417-424[Abstract/Free Full Text]
  32. Kim, S., McKay, R. R., Miller, K., and Shortridge, R. D. (1995) J. Biol. Chem. 270, 14376-14382[Abstract/Free Full Text]
  33. Shortridge, R. D., Yoon, J., Lending, C. R., Bloomquist, B. T., Perdew, M. H., and Pak, W. L. (1991) J. Biol. Chem. 266, 12474-12480[Abstract/Free Full Text]
  34. Bahk, Y. Y., Lee, Y. H., Lee, T. G., Seo, J., Ryu, S. H., and Suh, P. G. (1994) J. Biol. Chem. 269, 8240-8245[Abstract/Free Full Text]
  35. Kim, M. J., Min, D. S., Ryu, S. H., and Suh, P. G. (1998) J. Biol. Chem. 273, 3618-3624[Abstract/Free Full Text]
  36. Lemmon, M. A., Ferguson, K. M., and Schlessinger, J. (1996) Cell 85, 621-624[CrossRef][Medline] [Order article via Infotrieve]
  37. Rameh, L. E., Arvidsson, A., Carraway, K. L., III, Couvillon, A. D., Rathbun, G., Crompton, A., VanRenterghem, B., Czech, M. P., Ravichandran, K. S., Burakoff, S. J., Wang, D. S., Chen, C. S., and Cantley, L. C. (1997) J. Biol. Chem. 272, 22059-22066[Abstract/Free Full Text]
  38. Lemmon, M. A., Ferguson, K. M., O'Brien, R., Sigler, P. B., and Schlessinger, J. (1995) Proc. Natl. Acad. Sci. U. S. A. 92, 10472-10476[Abstract/Free Full Text]
  39. Tall, E., Dorman, G., Garcia, P., Runnels, L., Shah, S., Chen, J., Profit, A., Gu, Q. M., Chaudhary, A., Prestwich, G. D., and Rebecchi, M. J. (1997) Biochemistry 36, 7239-7248[CrossRef][Medline] [Order article via Infotrieve]
  40. Ferguson, K. M., Lemmon, M. A., Schlessinger, J., and Sigler, P. B. (1995) Cell 83, 1037-1046[CrossRef][Medline] [Order article via Infotrieve]
  41. Runnels, L. W., Jenco, J., Morris, A., and Scarlata, S. (1996) Biochemistry 35, 16824-16832[CrossRef][Medline] [Order article via Infotrieve]


Copyright © 1999 by The American Society for Biochemistry and Molecular Biology, Inc.

Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
J BiochemHome page
A. Akutagawa, K. Fukami, Y. Banno, T. Takenawa, R. Kannagi, Y. Yokoyama, K. Oda, M. Nagino, Y. Nimura, S. Yoshida, et al.
Disruption of Phospholipase C{delta}4 Gene Modulates the Liver Regeneration in Cooperation with Nuclear Protein Kinase C
J. Biochem., November 1, 2006; 140(5): 619 - 625.
[Abstract] [Full Text] [PDF]


Home page
J. Neurosci.Home page
F. Codazzi, A. Di Cesare, N. Chiulli, A. Albanese, T. Meyer, D. Zacchetti, and F. Grohovaz
Synergistic control of protein kinase Cgamma activity by ionotropic and metabotropic glutamate receptor inputs in hippocampal neurons.
J. Neurosci., March 29, 2006; 26(13): 3404 - 3411.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
M. Nakahara, M. Shimozawa, Y. Nakamura, Y. Irino, M. Morita, Y. Kudo, and K. Fukami
A Novel Phospholipase C, PLC{eta}2, Is a Neuron-specific Isozyme
J. Biol. Chem., August 12, 2005; 280(32): 29128 - 29134.