|
Originally published In Press as doi:10.1074/jbc.M003497200 on May 18, 2000
J. Biol. Chem., Vol. 275, Issue 32, 24829-24839, August 11, 2000
Identification of a Novel Sequence Involved in Lysosomal Sorting
of the Sphingolipid Activator Protein Prosaposin*
Qing
Zhao and
Carlos R.
Morales
From the Department of Anatomy and Cell Biology, McGill University,
Montreal, Quebec H3A 2B2, Canada
Received for publication, April 25, 2000
 |
ABSTRACT |
Prosaposin is synthesized as a 53-kDa protein,
post-translationally modified to a 65-kDa form and further glycosylated
to a 70-kDa secretory product. The 65-kDa protein is associated to Golgi membranes and is targeted to lysosomes, where four smaller nonenzymatic saposins implicated in the hydrolysis of sphingolipids are
generated by its partial proteolysis. The targeting of the 65-kDa
protein to lysosomes is not mediated by the mannose 6-phosphate receptor. The Golgi apparatus appears to accomplish the molecular sorting of the 65-kDa prosaposin by decoding a signal from its amino
acid backbone. This investigation deals with the characterization of
the sequence involved in this process by deleting the saposin functional domains A, B, C, and D and the highly conserved N and C
termini of prosaposin. The truncated cDNAs were subcloned into expression vectors and transfected to COS-7 cells. The destination of
the mutated proteins was assessed by immunocytochemistry. Deletion of
the C terminus did not interfere with the secretion of prosaposin but
abolished its transport to lysosomes. Deletion of saposins and the
N-terminal domain did not affect the lysosomal or secretory routing of
prosaposin. A chimeric construct of albumin and the C terminus of
prosaposin was not directed to lysosomes. However, albumin connected to
the C terminus and one or more functional domains of prosaposin reached
lysosomes, indicating that the C terminus and at least one saposin
domain are required for this process. In summary, we are reporting a
novel sequence involved in the targeting of prosaposin to lysosomes.
 |
INTRODUCTION |
Prosaposin is a 65-kDa protein that is proteolytically cleaved in
the lysosomes into four smaller active peptides, known as saposin A, B,
C, and D (1, 2). Saposins are detergent-like proteins required for the
hydrolysis of glycosphingolipids by specific hydrolases (2, 3).
Glycosphingolipids are components of the plasma membrane of eukaryotic
cells (4-6), which are degraded in the lysosomal compartment after
their endocytosis (7). Saposins A and C stimulate the hydrolysis of
glucosylceramide by -glucosylceramidase and galactosylceramide by
-galactosylceramidase (1, 3, 8, 9). Saposin B is the activator of
arylsulfatase A, -galactosidase, and -galactosidase (10, 11).
Saposin D was initially thought to be a sphingomyelinase activator
(12), but it is now accepted that it stimulates the degradation of
ceramide (13). The physiological importance of saposins has been
demonstrated in lysosomal disorders related to the deficiency of a
particular saposin causing accumulation of undigested
glycosphingolipids within cells. Lack of saposin B has been related to
a variant form of metachromatic leukodystrophy (14, 15), and the
deficiency of saposin C has been linked to a variant form of Gaucher's
disease (16). No lysosomal disorders have been reported due to
deficiencies of saposin A or D. However, a genetic disease caused by
the complete absence of prosaposin in humans (17) and a genetic
deficiency caused by the inactivation of the prosaposin gene in mutant
homozygous mice (18) resulted in multiple glycolipid elevation,
including lactosylceramidosis with normal sphingomyelinase activity.
Prosaposin also exists as a 70-kDa secretory protein found in several
biological fluids such as cerebrospinal fluid, milk, seminiferous
tubule fluid, and pancreatic secretion (19-21). The function of the
70-kDa protein is currently under investigation. Nevertheless,
secretory prosaposin has been implicated as a glycolipid transfer
protein (22, 23) and as a neurotrophic factor (24). In Schwann cells,
prosaposin has been found to activate the mitogen-activated protein kinase signaling pathway through a putative
G-protein-coupled receptor that is essential for enhanced sulfatide
synthesis (25) and to promote cell survival through the
phosphatidylinositol 3-kinase/Akt pathway (26).
The 70-kDa secretory prosaposin is a post-translationally modified form
of the 65-kDa lysosomal prosaposin (27, 28). This observation suggests
that the Golgi apparatus must decode a sorting signal from the 65-kDa
prosaposin to target it to the lysosomes before it is fully
glycosylated in the distal compartment of this organelle.
Lysosomal proteins use multiple targeting pathways: 1) delivery of
soluble hydrolases from the Golgi apparatus to late endosomes via the
mannose 6-phosphate receptor (29); 2) delivery of lysosomal membrane
proteins such as lysosomal acid phosphatase, lysosomal integral
membrane protein I, and lysosomal endosomal protein 100 by transport
through the endocytic pathway to endosomes and lysosomes (30-32); and
3) delivery of membrane proteins such as lysosomal associated membrane
protein (32) and lysosomal integral membrane protein II (33) from the
trans-Golgi apparatus to endosomes and lysosomes. A minor pathway may
route lysosomal associated membrane proteins to the lysosomes via the
plasma membrane (34). Lysosomal targeting of lysosomal associated
membrane protein and lysosomal integral membrane protein I depends on a
critical tyrosine-based motif, and lysosomal integral membrane protein
II targeting depends on a dileucine-based sorting determinant
present in 10-20 amino acids of their long cytoplasmic domains
(35-39).
Prosaposin reaches lysosomes by a mannose 6-phosphate-independent
mechanism that does not require glycosylation (40-43). Cultured human
fibroblasts from human patients with I-cell disease, which fail to
phosphorylate mannose residues on newly synthesized lysosomal proteins
have nearly normal levels of prosaposin and saposins in the lysosomes
(43, 44).
To identify the sequence responsible for the lysosomal routing of
prosaposin, deletions of different domains within this protein were
done. We observed that residues 521-557 of the C terminus and at least
one saposin domain are necessary for the sorting and targeting of
prosaposin to lysosomes.
 |
EXPERIMENTAL PROCEDURES |
Materials--
All restriction enzymes and modifying enzymes
were purchased from Amersham Pharmacia Biotech, Promega (Madison, WI),
Roche Molecular Biochemicals, Life Technologies, Inc., and Stratagene (La Jolla, CA). The pcDNA3.1B vector was bought from Invitrogen (Carlsbad, CA). The albumin cDNA clone was purchased from ATCC (Manassas, VA). Pepstatin A (isovaleryl-Val-Val-Sta-Ala-Sta) and phenylmethylsulfonyl fluoride were purchased from Sigma. Aprotinin, leupeptin, and (+)-brefeldin A
(BFA)1 were from Calbiochem.
Endoglycosidase H (Endo H) was from Roche Molecular Biochemicals.
Dulbecco's modified eagle medium (DMEM), fetal bovine serum, and
trypsin were bought from Life Technologies, Inc. DMEM without
methionine and cystine and L-glutamine,
L-methionine, L-glutamine, and cysteine were
purchased from Sigma-Aldrich. Nu-Serum V culture was from Becton
Dickinson Labware (Bedford, MA). ECL, Hybond nylon membrane was
purchased from Amersham Pharmacia Biotech. Bovine serum albumin was
from Roche Molecular Biochemicals, and Kodak X-Omat films were from
Eastman Kodak Co. (Rochester, NY). Tran35S-label was bought
from ICN (Irvine, CA). Lowicryl K4M was obtained from MecaLab
(Montreal, Canada). LysoTracker Red DND-99 was purchased from Molecular
Probes, Inc. (Eugene, OR).
Antibodies--
Anti-procathepsin B polyclonal antibody was a
gift from Dr. John Mort (Shriner Hospital, McGill University).
Mannosidase II polyclonal antibody was kindly provided by Dr. Marilyn
Farquhar (Yale University). Anti-Myc monoclonal antibody was
purchased from Invitrogen (Carlsbad, CA). Anti-prosaposin polyclonal
antibody was a gift from Dr. Michael D. Griswold (Washington State
University). Anti-mouse IgG1 conjugated to agarose, protein A
conjugated to agarose, goat anti-mouse IgG conjugated to fluorescein
isothiocyanate (FITC), goat anti-rabbit IgG conjugated to
tetramethylrhodamine isothiocyanate, and peroxidase-conjugated goat
anti-rabbit antibody were bought from Sigma-Aldrich. Goat anti-mouse
IgG conjugated to 10-nm colloidal gold particles and goat anti-rabbit
IgG conjugated to 15-nm colloidal gold particles were purchased from
Cedarlane (Hornby, Canada).
Recombinant cDNA Constructs--
A full-length prosaposin
cDNA was obtained by screening a mouse testicular cDNA library
(Stratagene, CA). Briefly, a PCR-amplified DNA fragment was labeled
with 32P and used as a probe (46). An aliquot containing 1 million recombinants was screened after transferring the plaques onto nitrocellulose membranes and by hybridizing them with the radioactive probe. Purified positive phages were grown, and the pBluescript plasmid
containing the insert was excised from the phage according to the
manufacturer's instructions. A full-length 2.6-kb prosaposin cDNA
in the plasmid was confirmed after sequencing both DNA strands and used
as a template for the different constructs made during this study. The
fidelity of individual constructs was confirmed by restriction mapping
and DNA sequencing (Sheldon Facility Center, McGill University)
Pro-WT is the wild type prosaposin cDNA subcloned into a mammalian
expression vector pcDNA3.1B. A pair of primers, Fc
(5'-cgccaccatgtacgccctcgccctc-3') and Rc
(5'-ggaattccacacatggcgtttgcaat-3'), was used to amplify a 1.6-kb
fragment consisting of the whole open reading frame of prosaposin by
PCR with vent DNA polymerase. A Kozak sequence CGCCACC was added to
primer Fc at the 5'-end. An EcoRI restriction site was added
to the 5'-end of primer Rc for suitable subcloning. The pcDNA3.1B
vector was digested with BamHI and filled in with a Klenow
fragment to create a blunt end. The vector was then digested with
EcoRI and purified, and the DNA concentration was estimated. PCR fragments were digested with EcoRI restriction enzyme,
purified, and subcloned into the prepared pcDNA3.1B vector. The
resulting plasmid was designated Pro-WT.
N-term and C-term are prosaposin constructs lacking part of the N
terminus (residues 17-59) and C terminus (residues 520-556). For the
N-term truncated construct, part of its N-terminal region in front
of the domain for saposin A was eliminated. An upstream primer Nf
(5'-agccctgtctcccttccttgcgacata-3') and downstream primer Nr
(5'-aggaagggagacagggctggtcagag-3') were designed according to the
sequence of prosaposin cDNA. Two pairs of primers, Fc/Nr and Nf/Rc,
were used in the first run of PCR. Fc/Rc primers were utilized in the
second run of PCR using amplified Fc/Nr fragment and Nf/Rc fragment as
templates. PCR fragment (1.6 kb) was digested by EcoRI
restriction enzyme and purified before subcloning into the prepared
pcDNA3.1B vector. The resulting plasmid construct was called
N-term.
For the C-term truncated construct, the same upstream Fc primer and
a new downstream primer COOHr (5'-ggaattcttataggcagaaggggcaa-3') were used to omit a sequence (LLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN) encoding the C terminus after the saposin D domain and subcloned into pcDNA3.1B vector.
A (residues 57-147), B (residues 189-278), C (residues
309-396), and D (residues 434-522) mutant plasmids are prosaposin constructs lacking individual saposin functional domains. Three pairs
of primers were used for each construct. The external primers Fc/Rc
were the same as for the Pro-WT construct. The two internal primers
were Af (5'-acagcgaaatacttggccgagcaaaac-3') and Ar
(5'-ggccaagtatttcgctgtgggcttg-3') for A; primers Bf
(5'-caacctaagccgagagtgccaatgaag-3') and Br (5'-cactctcttcttaggttggggctggct-3') for B; primers Cf
(5'-caggcccacgagttggtggaggcactt-3') and Cr
(5'-caccaactcgtgggcctggaccagat-3') for C; and primers Df
(5'-cctcagaagctgctgctgggaaccga-3') and Dr
(5'-cagcagcagcttctgaggaggcacatg-3') for D. All of these primers were
backwards to each other. The pairs of primers Fc/Ar and Af/Rc, Fc/Br
and Bf/Rc, Fc/Cr and Cf/Rc, and Fc/Dr and Df/Rc were used in the first
run of PCR for A, B, C, and D constructs, respectively.
Primers Fc/Rc were used in the second run of PCR using the amplified
Fc/Ar and Af/Rc fragments, Fc/Br and Bf/Rc fragments, Fc/Cr and Cf/Rc
fragments, and Fc/Dr and Df/Rc fragments as templates for each
construct. The final PCR products were purified and digested with
EcoRI and then subcloned into the prepared pcDNA3.1 B vector.
Alb/Pro-c-term, Alb/(Pro-D+Pro-c-term), Alb/(Pro-C,D+Pro-c-term),
and Alb-WT Constructs--
The first three fusion protein constructs
contain the full-length albumin and partial prosaposin sequences,
i.e. the C terminus of prosaposin (Alb/Pro-c-term), the
domain D plus the C terminus of prosaposin (Alb/Pro-D+Pro-c-term), and
the domains C and D plus the C terminus of prosaposin
(Alb/Pro-C,D+Pro-c-term). Alb-WT is wild type albumin. Three pairs of
primers were used in each of the chimeric constructs except in the wild
type albumin, which had one pair of primers (Alb-F/Alb-R) prepared
according to the nucleotide sequence of albumin. Primers Alb-F
(5'-cgccaccatgaagtgggtaacctttatttc-3') R-alb
(5'-cagcagcagccctaaggcagcttgactt-3'), F-alb
(5'-gccttagggctgctgctgggaaccga-3') and Rc were used for Alb/Pro-c-term.
Primers Alb-F, Dcooh-R (5'-cccaccattccctaaggcagcttgactt-3'), Dcooh-F
(5'-gccttagggaatggtgggttctgtgag-3'), and Rc were used for chimera
Alb/(Pro-D+Pro-c-term). Primers Alb-F, CDcooh-F
(5'-gccttagggaatctggtccaggcccac-3'), CDcooh-R
(5'-gaccagattccctaaggcagcttgactt-3'), and Rc were used for chimeric
construct Alb/(Pro-C,D+Pro-c-term). The pair of primers Alb-F/R-alb and
F-alb/Rc were used for chimeric construct Alb/(Pro-c-term); primers
Alb-F/Dcooh-R and Dcooh-F/Rc were used for chimeric construct Alb/(Pro-D+Pro-c-term); and primers Alb-F/CDcooh-R and CDcooh-F/Rc were
used for chimeric construct Alb/(Pro-C, D+Pro-c-term) in the first PCR
run. The amplified two fragments of each construct were mixed and used
as templates in the second run of PCR with the same pair of primer
Alb-F/Rc. Alb-F and Alb-R (5'-ggaattccctaaggcagcttgactt-3') were the
primers used for amplification of the wild type albumin (1.8 kb). Final
PCR products were purified and digested with EcoRI restriction enzyme and subcloned into the same pcDNA3.1B vector.
Cell Culture and Transfections--
COS-7 cells were maintained
in DMEM supplemented with 10% fetal bovine serum, 100 units/ml
penicillin, and 100 µg/ml streptomycin in an atmosphere of 5%
CO2 at 37 °C. Cells (60% confluence) grown on
coverslips (12 mm in diameter) in six-well dishes were transfected with
LipofectAMINE according to the manufacturer's instruction. Cells grown
in 100-mm Petri dishes were transfected according to the DEAE-dextran
method (76). Briefly, COS-7 cells (5 × 105) were
seeded into DMEM containing 10% Nu-Serum overnight. 5 µg of plasmid
DNA was mixed with 40 µl of 5% DEAE-dextran, 5 µl of 0.1 M chloroquine phosphate in 5 ml of DMEM with 10% Nu-Serum for 4 h. Cells were shocked with 10% Me2SO for 1 min,
rinsed with PBS, and replaced with DMEM containing 10% fetal bovine
serum for at least 48 h.
Metabolic Labeling, Immunoprecipitation, and Endo H
Digestion--
Cells were washed twice with PBS after 48 h of
transfection with different plasmid constructs and starved for 1 h
in starvation medium (DMEM lacking methionine and cysteine but
containing 5% dialyzed fetal bovine serum and 200 mM
glutamine). Cells were then pulsed in starvation medium supplemented
with Tran35S-label (300 µCi/ml) for the times indicated.
For experiments including chase periods, the radiolabeled medium was
removed, and cells were washed twice with PBS and incubated with cell
growth medium supplemented with unlabeled methionine (1.5 mg/ml) and cysteine (2.4 mg/ml) for the chase time indicated. When specified, cells were incubated with brefeldin A (20 µg/ml) for 1 h prior to the addition of medium containing the radiolabeled and fresh brefeldin A.
Monolayers of cells and media were collected. Cells were lysed with 1×
lysis buffer (1% Triton X-100, 150 mM NaCl, 10 mM Tris, pH 7.4, 1 mM EDTA, 1 mM
EGTA, pH 8.0, 0.2 mM sodium orthovanadate, 2 mM
phenylmethylsulfonyl fluoride, 0.5% Nonidet P-40, 10 µg/ml pepstatin
A, 10 µg/ml aprotinin, 10 mg/ml leupeptin). After treating with
primary anti-Myc antibody or anti-prosaposin antibodies bound to
anti-mouse IgG-agarose or protein A-agarose, the immunoprecipitates were washed three times with 1× lysis buffer. Samples were then resolved by SDS-PAGE, and radioactive signals were visualized by
fluorography. A 15% Tricine-SDS-PAGE was performed to resolve smaller
molecular weight proteins.
To digest the immunoprecipitates with endoglycosidase H, they were
released from agarose and antibodies first, by boiling in 50 µl of
1% SDS and 200 mM dithiothreitol for 5 min. An equal volume of 100 mM citric acid buffer (pH 5.5) and 1 unit of
endoglycosidase H was added to the immunoprecipitates and
incubated at 37 °C for 16 h. The processed samples were
resolved by 10% SDS-PAGE and detected by fluorography.
Immunofluorescent and LysoTracker Staining and Confocal
Microscopy--
For immunofluorescent staining, the cells transfected
with the wild type and mutated constructs were fixed with 3.8%
paraformaldehyde in 0.1 M phosphate buffer (pH 7.2) at room
temperature and washed with PBS. Cells were permeabilized with 0.5%
Triton X-100 in PBS for 30 min at room temperature and then blocked
with 10% goat serum in PBS for 1 h. After washing with PBS, the
cells were incubated with monoclonal antibody against Myc (1:100) and
polyclonal antibody against mannosidase II (1:500) at 4 °C
overnight. Following three washes in 0.05% Tween 20 in PBS, cells were
incubated with a 1:100 dilution of FITC-conjugated goat anti-mouse and
tetramethylrhodamine isothiocyanate-conjugated goat anti-rabbit
secondary antibodies. After three washes in 0.05% Tween 20 in PBS, the
cells were rinsed with double distilled H2O. Subsequently,
the coverslips were mounted on slides using Mowiol (Calbiochem).
Staining of acidic compartments was done on live COS-7 cells grown on
coverslips by adding LysoTracker (50 nM) to culture medium
for 30 min at 37 °C, followed by incubation in normal medium without
LysoTracker for 15 min. Cells were then immunostained as depicted
above. Cells were examined with a Zeiss Axiovert confocal microscope
with a ×63 objective and the appropriate filter set. Fluorescent
images were then resized using Adobe Photoshop.
Immunogold Labeling--
After 48 h of transfection with
different plasmid constructs, cells were detached from the culture
dishes with 0.1% trypsin in Hanks' balanced salt solution. The cells
were pelleted and fixed with 4% paraformaldehyde and 0.5%
glutaraldehyde in 0.05 M phosphate buffer. The cell pellets
were dehydrated in methanol and embedded in Lowicryl K11M as described
previously by Sylvester et al. (54).
Ultrathin Lowicryl sections were mounted on 300-mesh Formvar-coated
nickel grids (Polyscience Inc., Warrington, PA). Each section was then
floated for 15 min on a drop of 20 mM Tris-HCl-buffered saline (TBS) containing 15% (v/v) goat serum and then incubated for 30 min on a drop of anti-Myc monoclonal antibody diluted 1:50 in TBS. The
sections were then washed in TBS containing 0.05% Tween 20. After
blocking again with 15% goat serum, the sections were incubated with
10-nm colloidal gold-conjugated goat anti-mouse IgG. For double
staining with a lysosomal marker, sections were blocked and incubated
with a procathepsin B antibody (1:50) as described above. A 15-nm
colloidal gold-conjugated goat anti-rabbit secondary antibody was used.
Sections were counterstained with uranyl acetate in 30% ethanol (2 min) followed by lead citrate (30 s). Normal rabbit serum served as
control. Electron micrographs were taken on a Philips 400 electron microscope.
Western Blotting--
After 48 h of transfection with
different plasmid constructs, cells were rinsed twice with cold PBS,
lysed with 1× sample buffer (125 mM Tris, pH 6.8, 2% SDS,
5% glycerol, 1% -mecaptoethanol), and boiled for 5 min. 50 µg of
total protein were loaded and resolved in 10% SDS-PAGE gel and
transferred to 0.45-µm nitrocellulose membranes. Membranes were
blocked in 5% skimmed milk in TBS and probed with anti-Myc antibody,
followed by incubation with secondary antibody, horseradish
peroxidase conjugated to goat anti-mouse IgG. The membranes were
developed by ECL and exposed to x-ray films.
 |
RESULTS |
Analysis of Prosaposin Domains--
Alignment of amino acid
residues for saposins as well as the N and C termini of prosaposin
showed a similarity of 70-90% among different species (2, 3, 45, 46).
Each saposin contains 80 amino acids, 6 conserved cysteine residues
that form three internal disulfide bonds, an N-glycosylation
site, a conserved proline residue, and 14 or 15 hydrophobic amino acid
residues at the same position (46). Alignment between the N (residues 1-60) and C termini (residues 521-557) of prosaposin showed a 40%
identity and 66% similarity. A GenBankTM data base search
revealed a 70% similarity between 29 amino acids of the N terminus of
the human surfactant protein B (SP-B) and the C terminus of prosaposin.
This surfactant protein B sequence is involved in the transport of this
protein to the lamellar bodies of pneumocyte type II (47). A unique
characteristic of the lysosomal nature of lamellar bodies is the
content of hydrolases and a lysosomal membrane glycoprotein (48,
49).
Deletion of Prosaposin Functional Domains--
Based on the
analysis of prosaposin, saposin functional domains A, B, C, and D
and the N and C termini of prosaposin were deleted. The
truncated constructs were designated A, B, C, D, N-term,
and C-term to indicate the deleted region of the protein. Wild type
prosaposin was designated Pro-WT (Fig.
1A). The constructs were
subcloned into a mammalian expression vector, pcDNA3.1B, which
harbors a Myc epitope tag before the stop codon. Pro-WT and all
truncated mutants were transiently transfected into COS-7 cells. The
intracellular distribution of the constructs was assessed by
immunofluorescent staining with primary anti-Myc monoclonal antibody
and secondary FITC-conjugated goat anti-mouse antibody.

View larger version (22K):
[in this window]
[in a new window]
|
Fig. 1.
Effect of truncation on the lysosomal
transport of prosaposin. A, schematic representation of
wild type and truncated prosaposin constructs subcloned into the
pcDNA3.1B expression vector. Pro-WT is the wild type prosaposin
containing the full-length cDNA of prosaposin encoding the N
terminus (N-term), the saposin A, B, C, and D domains, and
the C terminus (C-term). The truncated constructs were
designated N-term (deletion of residues 17-59), A
(deletion of residues 57-147), B (deletion of residues 189-278),
C (deletion of residues 309-396), D (deletion of residues
404-522), and C-term (deletion of residues 520-556) to indicate
the specific regions deleted from prosaposin (shown by
dotted lines). B, expression of wild
type and truncated prosaposins after transfection into COS-7 cells.
Approximately 50 µg of whole cell lysates were subjected to a 10% SDS-PAGE, transferred onto a nylon membrane,
and immunoblotted with anti-Myc monoclonal antibody. Two bands
representing the 65- and 70-kDa wild type prosaposins (WT)
are indicated in the membrane. Mutants ( N-term, A, B, C,
D, and C-term) also produced two slightly lower bands depending
on the size of the truncated sequences. Nontransfected COS-7 cells
(COS-7) and COS-7 cells transfected with the vector alone
(V) were used as negative controls. C,
immunofluorescent staining of COS-7 cells after transfection with
expression vectors containing wild type (Pro-WT) and truncated
prosaposin ( N-term, A, B, C, D, and C-term). Primary
anti-Myc monoclonal antibody was visualized with a FITC-conjugated goat
anti-mouse antibody. Pro-WT (WT) and the mutant constructs
N-term, A, B, C, and D yielded Golgi-like perinuclear
and granular reactions. Cells transfected with C-term show a
Golgi-like perinuclear staining, but the granular reaction is seemingly
absent.
|
|
The two forms of wild type prosaposin (i.e. the 65-kDa
lysosomal form and the 70-kDa secretory form) were found by Western blot analysis with antibody against Myc in Pro-WT (Fig. 1B).
All mutants also produced the two forms of prosaposin with lower
molecular weights due to the truncation of their corresponding domains
(Fig. 1B). Confocal immunofluorescence of COS-7 cells
transfected with wild type prosaposin Pro-WT and A, B, C,
D, and N-term mutants with Myc antibody yielded both a
perinuclear and a granular reaction. Cells transfected with the
C-term mutant did not yield any granular staining, but the reaction
persisted in the perinuclear region (Fig. 1C).
To confirm whether the granular structures observed in Pro-WT and A,
B, C, D, and N-term were lysosomes, the lysosomal marker
LysoTracker was used as a probe. This marker is sensitive to low pH and
stains all acidic vesicles including the trans-Golgi region. The
LysoTracker (red fluorescence) showed overlap
with the punctate structures stained with Myc antibody
(green fluorescence) in Pro-WT, A, B, C,
D and N-term (Fig. 2A).
In C-term mutant, although the LysoTracker detected numerous
lysosomes, Myc antibody staining was negative in these granules (Fig.
2A).

View larger version (20K):
[in this window]
[in a new window]
|
Fig. 2.
Localization of wild type and truncated
prosaposin in COS-7 cells. A, colocalization of wild
type and truncated prosaposins after immunostaining with anti-Myc
antibody and LysoTracker (red fluorescence)
overlapped with punctate structures stained with anti-Myc monoclonal
antibody (green fluorescence). A partial overlap
was detected on a Golgi-like perinuclear region in wild type, Pro-WT
(WT), and N-term, A, B, C, and D mutants. No
overlap of punctate structures stained by LysoTracker was found in
C-term mutant due to the absence of granular staining with anti-Myc
antibody. B, colocalization of C-term mutant and
mannosidase II. Anti-mannosidase II polyclonal antibody was used as a
Golgi marker and visualized with a tetramethylrhodamine
isothiocyanate-conjugated goat anti-rabbit antibody. C-term mutant
was stained with anti-Myc monoclonal antibody and visualized with a
FITC-conjugated goat anti-mouse antibody. An overlap between the Myc
(green fluorescence) and mannosidase II
(red fluorescence) antibodies was observed in a
Golgi-like perinuclear region of COS-7 cells transfected with the
C-term construct. This result demonstrated that prosaposin mutations
did not affect the transit of the truncated protein from the ER to the
Golgi apparatus.
|
|
Since the Myc antibody yielded a perinuclear reaction reminiscent of
the Golgi apparatus in all of the constructs including the C-term
mutant, an anti-mannosidase II antibody was used as a Golgi marker.
Confocal immunostaining revealed an overlap between the two antibodies
in all constructs, including in the C-term mutant (Fig.
2B).
To further confirm the immunofluorescence results, a double immunogold
labeling was conducted on COS-7 cells transfected with the Pro-WT,
A, B, C, D, C-term, and N-term constructs and analyzed by electron microscopy. To accomplish this objective, goat
anti-mouse IgG conjugated to 10-nm gold was used to detect the
monoclonal Myc antibody, and goat anti-rabbit IgG conjugated to 15-nm
gold was used to detect the rabbit procathepsin B antibody. The results
showed a strong labeling with 10-nm gold particles and a weak labeling
with the 15-nm gold particles of electron-dense membrane-bound
structures in COS-7 cells transfected with the Pro-WT, A, B,
C, D, and N-term (Fig. 3). These
structures were considered to be lysosomes. However, in cells
transfected with the C-term construct, no labeling was found with
anti-Myc antibody in the lysosomes.

View larger version (119K):
[in this window]
[in a new window]
|
Fig. 3.
Immunogold labeling of COS-7 cells
transfected with Pro-WT (WT),
N-term, A,
B, C,
D, and C-term
constructs. Goat anti-mouse IgG conjugated to 10-nm gold particles
was used to detect monoclonal Myc antibody. Goat anti-rabbit IgG
conjugated to 15-nm gold particles (circled) was employed to
detect polyclonal procathepsin B antibody used as a lysosomal marker. A
strong immunogold labeling with 10-nm gold particles and weak
immunogold labeling with 15-nm gold particles were observed within the
lysosomes of COS-7 cells transfected with the Pro-WT, N-term, A,
B, C, and D constructs. No labeling with anti-Myc antibody was
found in the lysosomes of COS-7 cells transfected with C-term
mutant. Negative control (con) was immunogold-labeled in the
absence of the primary antibodies.
|
|
Metabolic Labeling Study--
To study the biosynthetic processing
of the wild type and truncated prosaposin in vivo, to
examine whether they were properly folded within the endoplasmic
reticulum (ER) and therefore transported to their destinations,
pulse-chase experiments were conducted using Tran35S-label.
COS-7 cells transfected with pcDNA3.1B vector alone or containing
the Pro-WT and the truncated constructs were incubated with
Tran35S-label for 30 min and chased for 30 min and 2 h. Cell lysates and samples from the medium were immunoprecipitated
with anti-Myc antibody and then subjected to SDS-polyacrylamide gel
electrophoresis and fluorography. As shown in Fig.
4A, the 65-kDa form was
visualized after 30 min in Pro-WT and in each of the truncated mutants
including the C-term. After chasing for 2 h, the amount of
65-kDa protein decreased in cell lysates, while the 70-kDa secretory
protein increased in the spent media. In the mutants, the
equivalents of the 65- and 70-kDa proteins were slightly smaller due to
their truncation. In the case of the C-term mutant, the increase of the secretory form in the medium was more prominent as confirmed by
densitometry (Fig. 4B). These data suggest that cells
transfected with the Pro-WT and the truncated mutants including
C-term produced properly folded proteins within the ER and that the
transport to the Golgi apparatus and secretion in the media was
not altered.

View larger version (38K):
[in this window]
[in a new window]
|
Fig. 4.
Effect of truncation on the synthesis,
targeting, and processing of prosaposin. A, pulse-chase
analysis of COS-7 cells transfected with pcDNA3.1B alone
(V) or with the same vector containing Pro-WT
(WT) and truncated constructs N-term, A, B, C,
D, and C-term. Cells were pulsed with Tran35S-label
(300 µci/ml) for 30 min and chased for 2 h and 30 min.
Cell lysates and culture medium were immunoprecipitated with anti-Myc
antibody and subjected to 10% SDS-PAGE and fluorographed.
A, both the 70- and 65-kDa prosaposins were present
intracellularly. B, in the medium, only the 70-kDa secretory
form was present. C, detection of mature saposins in COS-7
cells transfected with Pro-WT and C-term after labeling with
Tran35S-label. COS-7 cells transfected with Pro-WT(WT) and
C-term were labeled with Tran35S-label (300 µci/ml)
for 5 h prior to immunoprecipitation with anti-prosaposin
antibody. Immunoprecipitates were subjected to a 15% Tricine-SDS-PAGE
followed by fluorography. A 15-kDa band corresponding to saposins was
observed in cells transfected with the Pro-WT but absent in cells
transfected with the C-term. The major band (65 kDa) in WT and a
slightly smaller band in the C-term mutant represent the lysosomal
precursor of saposins. COS-7 cells transfected with pcDNA3.1B
vector alone were used as negative control.
|
|
Although the C-term mutation abolished the transport of prosaposin
to the lysosomes, it did not interfere with its secretion. Since the
C-term mutant protein did not reach the lysosomes, it was predicted
that COS-7 cells transfected with this construct would not yield mature
saposins as opposed to cells transfected with the Pro-WT construct. To
confirm if this was the case, cells transfected with C-term and
Pro-WT were subjected to a longer pulse labeling experiment with
Tran35S-label (Fig. 4C) to detect the
proteolytically cleaved saposins. After 5 h of labeling, cell
lysates were immunoprecipitated with anti-prosaposin antibody, which
recognizes both prosaposin and mature lysosomal saposins. The
immunoprecipitates were resolved in a 15% Tricine-SDS-PAGE and
fluorographed. Wild type 65-70-kDa and C-term slightly smaller
prosaposins were detected in cell lysates (Fig. 4C). As
expected, mature saposins were not observed in cells transfected with
the C-term construct but present in the cells transfected with the
Pro-WT construct.
The Addition of Prosaposin Functional Domains to a Secretory
Protein--
To determine whether the C terminus alone was sufficient
for intracellular targeting, a chimeric protein encoding the
full-length cDNA of albumin plus the C terminus of prosaposin
(Alb/Pro-c-term) was constructed and subcloned into the pcDNA3.1B
vector and transfected into COS-7 cells. Wild type albumin cDNA was
also prepared as a control (Alb). Albumin is a secretory protein that
reaches the extracellular space by a constitutive secretory pathway.
After transfection, cells were immunostained with anti-Myc antibody, followed by a secondary FITC-conjugated goat anti-mouse antibody. Some
cells were simultaneously stained with LysoTracker. Myc antibody (green fluorescence) produced a perinuclear
Golgi-like reaction (Fig. 5A).
However, the punctate structures stained by LysoTracker (red
fluorescence) did not react with anti-Myc antibody. This suggested that the C terminus alone was insufficient to drive albumin
to lysosomes. Based on this result and on the mutational analysis of
prosaposin, it was hypothesized that one or more saposin domains should
also be present along with the C terminus to direct albumin to the
lysosomes.

View larger version (32K):
[in this window]
[in a new window]
|
Fig. 5.
Expression and targeting of chimeric
constructs. A, targeting of chimeric proteins to the
lysosomes. A typical Golgi-like reaction (green
fluorescence) was observed in COS-7 cells transfected with
Alb/Pro-c-term as well as with the wild type albumin
(Alb-WT). A Golgi-like reaction plus a prominent
lysosome-like staining was achieved with the Alb/(Pro-D+Pro-c-term) and
Alb/(Pro-C,D+Pro-c-term) constructs (green
fluorescence). LysoTracker staining (red
fluorescence) was seen in COS-7 cells transfected with the
different constructs. The punctate reaction obtained with anti-Myc
(green fluorescence) in Alb/(Pro-D+Pro-c-term)
and Alb/(Pro-C, D+Pro-c-term) overlapped with LysoTracker staining
(red fluorescence). This experiment demonstrated
that the prosaposin domain plus the C terminus are required for the
transport of albumin to the lysosomes. B, Western blot
analysis of wild type and albumin chimeric proteins. COS-7 cells
transfected with wild type albumin (Alb-WT) and chimeric constructs
Alb/Pro-c-term, Alb/(Pro-D+Pro-c-term), and Alb/(Pro-C, D+Pro-c-term)
were lysed and subjected to a 10% SDS-PAGE, transferred onto a nylon
membrane, and immunostained with anti-Myc monoclonal antibody. The
molecular mass of wild type albumin (Alb-WT) is indicated by an
arrow (66 kDa). Other bands with higher molecular masses
correspond to the chimeric proteins.
|
|
To test this hypothesis, a chimeric protein was engineered by fusing an
albumin cDNA with nucleotide sequences encoding domain D and the C
terminus of prosaposin (Alb/Pro-D, c-term). In addition, an albumin
fusion protein containing domains C and D plus the C terminus of
prosaposin (Alb/Pro-C, D, c-term) was also constructed. Anti-Myc
antibody yielded a punctate reaction in both chimeras (Fig.
5A), which overlapped with LysoTracker staining. Western blotting with Myc antibody confirmed the expression of wild type and
chimeric albumin proteins (Fig. 5B).
Endo H Treatment of Prosaposin--
The difference between the
65-kDa and 70-kDa prosaposins is due to their glycosylation state (55).
To determine the structures of their N-linked carbohydrates
and to identify the potential sorting compartment for the lysosomal
precursor within the Golgi apparatus, endoglycosidase H digestion was
performed on immunoprecipitated proteins. Anti-Myc antibody was used to
immunoprecipitate recombinant prosaposins from lysates of COS-7 cells
transfected with wild type Pro-WT and mutated constructs. Results
revealed that in all cases, the 65-kDa band shifted to a 53-kDa band,
which corresponds to the molecular weight of the native form of
prosaposin (55). The less prominent protein band corresponding to the
70-kDa protein was resistant to Endo H treatment (Fig.
6A). Similarly, the 70-kDa secretory protein immunoprecipitated from the medium was Endo H-resistant (Fig. 6B). This result suggested that the 65-kDa
lysosomal form of prosaposin exits from the cis/medial compartment of
the Golgi, while the 70-kDa protein traversed the Golgi apparatus, completing its terminal glycosylation.

View larger version (54K):
[in this window]
[in a new window]
|
Fig. 6.
Treatment with Endo H of COS-7 cells
transfected with wild type Pro-WT (WT) and
N-term, A,
B, C,
D, and C-term prosaposin
constructs. After transfection with Pro-WT and truncated
constructs, COS-7 cells were labeled with Tran35S-label
(300 µci/ml) for 30 min and chased for 2 h. Cell lysates and
culture medium were immunoprecipitated with anti-Myc antibody and
incubated with Endo H (1 unit) at 37 °C for 16 h.
Immunoprecipitated proteins were resolved in a 10% SDS-PAGE followed
by fluorography. A, in cell lysates, the 65-kDa protein band
shifted to a 53-kDa band, and the less prominent 70-kDa band remained
unchanged (Endo H +). Similar band patterns were
also observed with the truncated prosaposins ( N-term, A, B,
C, D, and C-term) with slightly smaller molecular masses due
to the truncations. B, in culture medium, the 70-kDa
(WT) band, representing the secretory form of prosaposin,
was not modified after incubation with Endo H. Similar results were
obtained with truncated prosaposins ( N-term, A, B, C, D,
and C-term). COS-7 cells transfected with the vector alone
(Vector) were used as a negative control.
|
|
Treatment with BFA--
To verify whether the Golgi
apparatus was the site where the 65-kDa lysosomal precursor was sorted,
BFA was used prior to Tran35S-labeled pulse-chase
experiments. BFA is a fungal metabolite that causes rapid
redistribution of the components of the Golgi apparatus to the ER (50,
51). COS-7 cells transfected with the wild type prosaposin (Pro-WT)
were incubated with BFA 1 h prior to Tran35S-labeling.
In the presence of BFA, the amount of intracellular protein in cell
lysates remained unchanged after chasing for 4 h, while in cells
not treated with BFA, the amount of protein decreased after chasing for
2 h (Fig. 7). In the medium of cells incubated with BFA, there was a very low amount of the 70-kDa protein
after chasing for 30 min, 2 h, and 4 h. This indicated that
the 70-kDa secretory protein present before the supplementation of BFA
was beyond the proximal compartment of the Golgi apparatus. In
contrast, in cells incubated without BFA, the amount of protein in the
medium increased after 30 min and 2 h (Fig. 7). Taken together, these data suggest that the 65-kDa lysosomal precursor contains mainly
high mannose sugar residues and that it is present in the proximal
aspect of the Golgi apparatus. On the other hand, the 70-kDa secretory
form is glycosylated with complex/hybrid sugar residues and appear to
exit from the distal region of the Golgi apparatus.

View larger version (17K):
[in this window]
[in a new window]
|
Fig. 7.
Pulse-chase of COS-7 cells transfected with
Pro-WT treated with BFA. Cells were incubated with BFA (20 µg/ml) (+BFA) 1 h prior to the addition of
Tran35S-label (300 µCi/ml). Replicas of COS-7 cells were
grown in absence of BFA and used as controls. After labeling for 30 min, cells were chased for an additional 30 min, 2 h, and 4 h. Immunoprecipitates of cell lysates and culture medium were resolved
in a 10% SDS-PAGE and fluorographed. BFA caused intracellular
retention of the 65-kDa protein. In control cells, the 65-kDa protein
decreased intracellularly, while the 70-kDa protein increased in
control medium.
|
|
 |
DISCUSSION |
Prosaposin exists as a 65-kDa lysosomal precursor that is routed
to the lysosomes and a 70-kDa secretory form that is secreted to the
extracellular space (27, 41, 52-54). Time course experiments demonstrated that the 65-kDa form is derived from post-translational modification of a 53-kDa native protein and that is the
precursor of the 70 kDa secretory prosaposin (55). Prosaposin is highly conserved from avian to mammals (45, 46). Conserved regions of
prosaposin include four saposin domains designated A, B, C, and D (1)
and its N and C termini. Little or no conservation exist among the
linker regions found between domains A and B, B and C, and C and D (45,
46). In lysosomes, the 65-kDa protein is cleaved into four sphingolipid
activator proteins termed saposins A-D, which are essential cofactors
for the hydrolysis of glycosphingolipids with short oligosaccharide
chains by specific hydrolases (56, 57).
The dichotomy of prosaposin's lysosomal and secretory pathways raises
a number of interesting questions such as how a fraction of the 65-kDa
protein escapes terminal glycosylation and what is the mechanism
utilized by the lysosomal prosaposin to leave the Golgi apparatus.
Prosaposin, unlike most lysosomal hydrolases, is targeted to lysosomes
by a mannose 6-independent mechanism (41-43). The transport of soluble
hydrolases to lysosomes depends on their mannose 6-phosphate residues
that are recognized by the mannose 6-phosphate receptor in the
trans-Golgi region (29, 34, 58). The ligand-receptor complex is then
carried to lysosomes via a clathrin-coated vesicle. The 65-kDa protein
has been shown to be associated with Golgi membranes (41). In
vitro assays demonstrated that prosaposin and lysosomal saposins
are capable of binding sphingolipids (22, 59, 60). Incubation of cells
with tunicamycin did not interfere with the transit of the
nonglycosylated 53-kDa form of prosaposin from the ER to the Golgi
apparatus nor with its association to Golgi membranes (41). Moreover,
as a result of tunicamycin treatment, the nonglycosylated prosaposin
was transported to the lysosomes more efficiently (41). This suggested
that the sorting and targeting of the 65-kDa prosaposin within the
Golgi apparatus might be dependent on a protein-protein or
protein-lipid interaction. To test this hypothesis and to determine
whether or not a specific domain of prosaposin is involved in this
process, a wild type prosaposin cDNA and several truncated
constructs were subcloned into a mammalian expression vector and
transfected into COS-7 cells. The recombinant constructs contained a
Myc epitope tag that allowed their identification from endogenous
prosaposin during the course of our immunochemical studies. The
lysosomal marker LysoTracker was also used to identify lysosomes by
confocal microscopy. Confocal immunofluorescence demonstrated that
deletion of individual domains encoding saposin A, B, C, or D or the N
terminus did not interfere with the targeting of prosaposin to the
lysosomal compartment. On the other hand, deletion of the C terminus
abolished the targeting of prosaposin to lysosomes. To check if these
deletions caused retention of mutated prosaposin in the ER, COS-7 cells
were metabolically labeled with Tran35S-label and chased.
Cell lysates and culture medium were immunoprecipitated and
fluorographed. The results demonstrated the presence of the equivalent
65- and 70-kDa proteins of prosaposin in the cell lysates and of the
70-kDa secretory protein in the medium. In summary, our results clearly
indicated that deletions of the A, B, C, D, N-term, and
C-term did not cause retention of prosaposin in the ER and that the
presence of the C terminus of prosaposin was essential for the sorting
and targeting of prosaposin to the lysosomes.
To verify if the C terminus alone was sufficient for driving prosaposin
to the lysosomes, a chimeric fusion protein between albumin and the C
terminus of prosaposin was expressed in COS-7 cells using the same
vector. A vector containing the cDNA of albumin alone was used as a
control. As expected for a secretory protein, wild type albumin was
detected in the culture medium. However, chimeric albumin fused with
the C terminus of prosaposin was not found within lysosomes. Instead,
it was secreted into the culture medium.
We rationalized then that truncated constructs A, B, C, D,
and N-term, which were targeted to lysosomes, contained the C
terminus and at least three saposins. Since saposins display, among
themselves, similar structure and play similar roles in vivo
and in vitro, we decided to test the hypothesis that one or
more saposin domains plus the C terminus are required for the transport
of prosaposin to lysosomes. Thus, two new fusion plasmids were made.
The first one was composed of albumin plus domain D and the C terminus
of prosaposin. The second construct was made of albumin plus domains C
and D and the C terminus of prosaposin. As predicted, confocal
immunostaining demonstrated that albumin was routed to the lysosomal
compartment when it was connected to one saposin domain plus the C
terminus of prosaposin.
Each saposin has a high degree of interspecies similarity of
hydrophobic amino acids (45, 46). The percentage of hydrophobic amino
acids is 36% in saposin A, 37% in B, 28% in C, and 39% in D (45).
This high degree of conservation of hydrophobic residues and their
alignment occupying equivalent positions with their side chains buried
in the folded structure (46) underlines the capacity of saposins to
interact with lipids. In fact, the interaction between prosaposin and
its derived saposins with sphingolipids has been extensively documented
(22, 59, 61). Saposins C and D have also been shown to exhibit a high
affinity for phospholipids. Furthermore, the presence of acidic
phospholipids such as phosphatidylserine in membrane bilayers greatly
favors their binding to saposin D (61). The interaction with
phospholipids is a characteristic of several other saposin-like
proteins (62), such as SP-B (63). Others members of the saposin-like
protein family include the pore-forming peptide of Entamoeba
hystolytica (64, 65), NK-lysin (66), acid sphingomyelinase
(67), acyloxylacyl hydrolase (68), and plant aspartic proteinases (69,
70). Saposin-like proteins differ widely in function, but the activity
of most of them is mediated via lipid interactions. Interestingly, the
saposin-like domain within aspartic proteinase has been implicated in
the vacuolar targeting of this protein by means of its interaction with
membrane phospholipids (69).
Lysosomal prosaposin was initially found to be targeted to lysosomes in
a mannose 6-phosphate-independent manner (40, 41, 43). When isolated
Golgi fractions were permeabilized with a mild detergent (41),
lysosomal prosaposin remained associated to the membrane, while
secretory prosaposin (70 kDa) was released into the incubation medium.
This suggests that the interaction of lysosomal prosaposin with
phospholipid or sphingolipids may play a role in sorting and targeting
this protein to the lysosomes. Recently, sphingomyelin, a membrane
sphingolipid manufactured in the cis/medial region of the Golgi
apparatus (71), was demonstrated to be involved in the transport of
prosaposin to lysosomes (72). Cultured cells incubated with fumonisin
B1, an inhibitor of sphingolipid synthesis that competes with
sphinganine as a substrate of ceramide synthase (73), produced a
dramatic decrease in the immunogold labeling of lysosomes with
anti-prosaposin antibody. To examine if the mannose 6-phosphate
receptor-mediated pathway was affected by this treatment, cells treated
or not treated with fumonisin B1 were labeled with anti-cathepsin A
antibody. The results showed no significant differences in the
immunogold labeling of the lysosomal compartment of the treated and
nontreated cells, indicating that the effect of fumonisin B1 on the
transport of prosaposin to the lysosomes was specific. The effect of
DL-threo-1-phenyl-2-decanoyl-amino-3-morpholino-1-propanol-HCL, a compound that selectively inhibits the synthesis of
glycosphingolipids but not of sphingomyelin and/or ceramide, and the
effect of tricyclodecan-9-yl xanthate potassium (D609), which
specifically blocks the formation of sphingomyelin (74), were also
examined. The results showed that only D609 blocked the transport of
prosaposin to the lysosomes, suggesting that sphingomyelin was the main
sphingolipid implicated in the association with prosaposin to the
lysosomes (72).
During the course of this investigation we showed that the 65-kDa
lysosomal prosaposin is Endo H-sensitive, whereas the 70-kDa secretory
form is Endo H-resistant. Since the processing pathway within the Golgi
apparatus is highly ordered, the treatment with this enzyme was used to
distinguish complex from high mannose oligosaccharide linked to
prosaposin (29, 75). Glycoproteins are modified in successive stages as
they move through the Golgi-processing compartment. Thus, a significant
fraction of the 65-kDa form must escape from the Golgi apparatus before
it reaches the distal stacks, where it becomes fully glycosylated and
Endo H-resistant. This notion was confirmed in cells transfected with
the wild type prosaposin after incubation in BFA. BFA is a fungal
antibacterial drug that causes rapid redistribution of proteins located
in the Golgi apparatus but not of proteins residing in a post-Golgi
compartment. Our results showed an intracellular retention of the
65-kDa protein, indicating that the lysosomal form only reaches the
cis/medial region of the Golgi apparatus before sorting. The presence
of negligible amounts of the 70-kDa protein in the medium represented secretory prosaposin that already passed the distal region of the Golgi
prior to the addition of BFA.
Based on this evidence, a model, in which the interaction of prosaposin
with phospholipids and/or sphingolipids may play an important role in
bringing prosaposin close to the Golgi membrane near a "receptor
protein," was proposed. According to this model, the C terminus of
prosaposin may contain the binding site for this receptor protein,
creating a receptor-ligand-like complex, which is then packed into
cargo vesicles and transported to the endosomes, multivesicular
bodies, and/or lysosomes. Interestingly, the C terminus of
prosaposin is significantly similar (66%) to the N terminus of SP-B,
which has been implicated in the targeting of this protein to the
lamellar bodies in pneumocyte type II (47). Similar to prosaposin,
which requires the C terminus and at least one saposin domain, SP-B
also requires the presence of the N-terminal region and a yet
unidentified sequence within the backbone of this protein that contains
a saposin-like domain. Taken together, all of these results indicate
that an alternative mechanism of sorting and transport of prosaposin
between the Golgi apparatus and the lysosomes may exist. In conclusion,
we demonstrated that the C terminus and at least one saposin domain may
be sufficient for the lysosomal sorting and targeting of this
sphingolipid activator protein.
 |
FOOTNOTES |
*
This work was supported by the Medical Research Council,
Canada.The costs of publication of this
article were defrayed in part by the
payment of page charges. The article
must therefore be hereby marked
"advertisement" in
accordance with 18 U.S.C. Section
1734 solely to indicate this fact.
Fellow of Fonds de la Recherche en Santé du
Québec. To whom correspondence should be addressed: Dept. of
Anatomy and Cell Biology, McGill University, 3640 University St.,
Montreal, Quebec H3A 2B2, Canada. Tel.: 514-398-6398; Fax:
514-398-5047; E-mail: cxco@musica.mcgill.ca.
Published, JBC Papers in Press, May 18, 2000, DOI 10.1074/jbc.M003497200
 |
ABBREVIATIONS |
The abbreviations used are:
BFA, brefeldin A;
DMEM, Dulbecco's modified Eagle's medium;
FITC, fluorescein
isothiocyanate;
PCR, polymerase chain reaction;
kb, kilobase pair(s);
PBS, phosphate-buffered saline;
PAGE, polyacrylamide gel
electrophoresis;
Tricine, N-[2-hydroxy-1,1-bis(hydroxymethyl)ethyl]glycine;
TBS, Tris-HCl-buffered saline;
SP-B, surfactant protein B;
ER, endoplasmic
reticulum;
Endo H, endoglycosidase H.
 |
REFERENCES |
| 1.
|
Morimoto, S.,
Martin, B. M.,
Yamamoto, Y.,
Kretz, K. A.,
O'Brien, J. S.,
and Kishimoto, Y.
(1989)
Proc. Natl. Acad. Sci. U. S. A.
86,
3389-3393
|
| 2.
|
O'Brien, J. S.,
and Kishimoto, Y.
(1991)
FASEB J.
5,
301-308
|
| 3.
|
Kishimoto, Y.,
Hiraiwa, M.,
and O'Brien, J. S.
(1992)
J. Lipid Res.
33,
1255-1267
|
| 4.
|
Hakomori, S.
(1981)
Annu. Rev. Biochem.
50,
733-764
|
| 5.
|
Hakomori, S.
(1993)
Biochem. Soc. Trans.
21,
583-595
|
| 6.
|
Rademacher, T. W.,
Parekh, R. B.,
and Dwek, R. A.
(1988)
Annu. Rev. Biochem.
57,
785-838
|
| 7.
|
Griffiths, G.,
Hoflack, B.,
Simons, K.,
Mellman, I.,
and Kornfeld, S.
(1988)
Cell
52,
329-341
|
| 8.
|
Glew, R. H.,
Basu, A.,
LaMarco, K. L.,
and Prence, E. M.
(1988)
Lab. Invest.
58,
5-25
|
| 9.
|
Wenger, D. A.,
Sattler, M.,
and Roth, S.
(1982)
Biochim. Biophys. Acta
712,
639-649
|
| 10.
|
Inui, K.,
Emmett, M.,
and Wenger, D. A.
(1983)
Proc. Natl. Acad. Sci. U. S. A.
80,
3074-3077
|
| 11.
|
Vogel, A.,
Furst, W.,
Abo-Hashish, M. A.,
Lee-Vaupel, M.,
Conzelmann, E.,
and Sandhoff, K.
(1987)
Arch. Biochem. Biophys.
259,
627-638
|
| 12.
|
Morimoto, S.,
Martin, B. M.,
Kishimoto, Y.,
and O'Brien, J. S.
(1988)
Biochem. Biophys. Res. Commun.
156,
403-410
|
| 13.
|
Klein, A.,
Henseler, M.,
Klein, C.,
Suzuki, K.,
Harzer, K.,
and Sandhoff, K.
(1994)
Biochem. Biophys. Res. Commun.
200,
1440-1448
|
| 14.
|
Kretz, K. A.,
Carson, G. S.,
Morimoto, S.,
Kishimoto, Y.,
Fluharty, A. L.,
and O'Brien, J. S.
(1990)
Proc. Natl. Acad. Sci. U. S. A.
87,
2541-2544
|
| 15.
|
Rafi, M. A.,
Zhang, X. L.,
DeGala, G.,
and Wenger, D. A.
(1990)
Biochem. Biophys. Res. Commun.
166,
1017-1023
|
| 16.
|
Christomanou, H.,
Aignesberger, A.,
and Linke, R. P.
(1986)
Biol. Chem. Hoppe Seyler
367,
879-890
|
| 17.
|
Bradova, V.,
Smid, F.,
Ulrich-Bott, B.,
Roggendorf, W.,
Paton, B. C.,
and Harzer, K.
(1993)
Hum. Genet.
92,
143-152
|
| 18.
|
Fujita, N.,
Suzuki, K.,
Vanier, M. T.,
Popko, B.,
Maeda, N.,
Klein, A.,
Henseler, M.,
Sandhoff, K.,
and Nakayasu, H.
(1996)
Hum. Mol. Genet.
5,
711-725
|
| 19.
|
Kondoh, K.,
Hineno, T.,
Sano, A.,
and Kakimoto, Y.
(1991)
Biochem. Biophys. Res. Commun.
181,
286-292
|
| 20.
|
Sylvester, S. R.,
Skinner, M. K.,
and Griswold, M. D.
(1984)
Biol. Reprod.
31,
1087-1101
|
| 21.
|
Hiraiwa, M.,
O'Brien, J. S.,
Kishimoto, Y.,
Galdzicka, M.,
Fluharty, A. L.,
Ginns, E. I.,
and Martin, B. M.
(1993)
Arch. Biochem. Biophys.
304,
110-116
|
| 22.
|
Hiraiwa, M.,
Soeda, S.,
Kishimoto, Y.,
and O'Brien, J. S.
(1992)
Proc. Natl. Acad. Sci. U. S. A.
89,
11254-11258
|
| 23.
|
Lamontagne, S.,
and Potier, M.
(1994)
J. Biol. Chem.
269,
20528-20532
|
| 24.
|
O'Brien, J. S.,
Carson, G. S.,
Seo, H. C.,
Hiraiwa, M.,
Weiler, S.,
Tomich, J. M.,
Barranger, J. A.,
Kahn, M.,
Azuma, N.,
and Kishimoto, Y.
(1995)
FASEB J.
9,
681-685
|
| 25.
|
Campana, W. M.,
Hiraiwa, M.,
and O'Brien, J. S.
(1998)
FASEB J.
12,
307-314
|
| 26.
|
Campana, W. M.,
Darin, S. J.,
and O'Brien, J. S.
(1999)
J. Neurosci. Res.
57,
332-341
|
| 27.
|
Igdoura, S. A.,
and Morales, C. R.
(1995)
Mol. Reprod. Dev.
40,
91-102
|
| 28.
|
Rosenthal, A. L.,
Igdoura, S. A.,
Morales, C. R.,
and Hermo, L.
(1995)
Mol. Reprod. Dev.
40,
69-83
|
| 29.
|
von Figura, K.,
and Hasilik, A.
(1986)
Annu. Rev. Biochem.
55,
167-193
|
| 30.
|
Braun, M.,
Waheed, A.,
and von Figura, K.
(1989)
EMBO J.
8,
3633-3640
|
| 31.
|
Fambrough, D. M.,
Takeyasu, K.,
Lippincott-Schwartz, J.,
and Siegel, N. R.
(1988)
J. Cell Biol.
106,
61-67
|
| 32.
|
Mathews, P. M.,
Martinie, J. B.,
and Fambrough, D. M.
(1992)
J. Cell Biol.
118,
1027-1040
|
| 33.
|
Maillet, C. M.,
and Shur, B. D.
(1993)
Exp. Cell Res.
208,
282-295
|
| 34.
|
Rohrer, J.,
Schweizer, A.,
Russell, D.,
and Kornfeld, S.
(1996)
J. Cell Biol.
132,
565-576
|
| 35.
|
Williams, M. A.,
and Fukuda, M.
(1990)
J. Cell Biol.
111,
955-966
|
| 36.
|
Harter, C.,
and Mellman, I.
(1992)
J. Cell Biol.
117,
311-325
|
| 37.
|
Guarnieri, F. G.,
Arterburn, L. M.,
Penno, M. B.,
Cha, Y.,
and August, J. T.
(1993)
J. Biol. Chem.
268,
1941-1946
|
| 38.
|
Honing, S.,
Griffith, J.,
Geuze, H. J.,
and Hunziker, W.
(1996)
EMBO J.
15,
5230-5239
|
| 39.
|
Sandoval, I. V.,
Arredondo, J. J.,
Alcalde, J.,
Gonzalez Noriega, A.,
Vandekerckhove, J.,
Jimenez, M. A.,
and Rico, M.
(1994)
J. Biol. Chem.
269,
6622-6631
|
| 40.
|
Rijnboutt, S.,
Kal, A. J.,
Geuze, H. J.,
Aerts, H.,
and Strous, G. J.
(1991)
J. Biol. Chem.
266,
23586-23592
|
| 41.
|
Igdoura, S. A.,
Rasky, A.,
and Morales, C. R.
(1996)
Cell Tissue Res.
283,
385-394
|
| 42.
|
Zhu, Y.,
and Conner, G. E.
(1994)
J. Biol. Chem.
269,
3846-3851
|
| 43.
|
Vielhaber, G.,
Hurwitz, R.,
and Sandhoff, K.
(1996)
J. Biol. Chem.
271,
32438-32446
|
| 44.
|
Morimoto, S.,
Yamamoto, Y.,
O'Brien, J. S.,
and Kishimoto, Y.
(1990)
Anal. Biochem.
190,
154-157
|
| 45.
|
Azuma, N.,
Seo, H. C.,
Lie, O.,
Fu, Q.,
Gould, R. M.,
Hiraiwa, M.,
Burt, D. W.,
Paton, I. R.,
Morrice, D. R.,
O'Brien, J. S.,
and Kishimoto, Y.
(1998)
Biochem. J.
330,
321-327
|
| 46.
|
Zhao, Q.,
Bell, A. W.,
El-Alfy, M.,
and Morales, C. R.
(1998)
J. Androl.
19,
165-174
|
| 47.
|
Lin, S.,
Akinbi, H. T.,
Breslin, J. S.,
and Weaver, T. E.
(1996)
J. Biol. Chem.
271,
19689-19695
|
| 48.
|
Hook, G. E.,
and Gilmore, L. B.
(1982)
J. Biol. Chem.
257,
9211-9220
|
| 49.
|
Voorhout, W. F.,
Veenendaal, T.,
Haagsman, H. P.,
Weaver, T. E.,
Whitsett, J. A.,
van Golde, L. M.,
and Geuze, H. J.
(1992)
Am. J. Physiol.
263,
L479-L486
|
| 50.
|
Misumi, Y.,
Miki, K.,
Takatsuki, A.,
Tamura, G.,
and Ikehara, Y.
(1986)
J. Biol. Chem.
261,
11398-11403
|
| 51.
|
Lippincott-Schwartz, J.,
Yuan, L. C.,
Bonifacino, J. S.,
and Klausner, R. D.
(1989)
Cell
56,
801-813
|
| 52.
|
Collard, M. W.,
Sylvester, S. R.,
Tsuruta, J. K.,
and Griswold, M. D.
(1988)
Biochemistry
27,
4557-4564
|
| 53.
|
O'Brien, J. S.,
Kretz, K. A.,
Dewji, N.,
Wenger, D. A.,
Esch, F.,
and Fluharty, A. L.
(1988)
Science
241,
1098-1101
|
| 54.
|
Sylvester, S. R.,
Morales, C.,
Oko, R.,
and Griswold, M. D.
(1989)
Biol. Reprod.
41,
941-948
|
| 55.
|
Igdoura, S. A.,
Hermo, L.,
Rosenthal, A.,
and Morales, C. R.
(1993)
Anat. Rec.
235,
411-424
|
| 56.
|
Kolter, T.,
and Sandhoff, K.
(1998)
Brain Pathol.
8,
79-100
|
| 57.
|
Sandhoff, K.,
and Kolter, T.
(1997)
Clin. Chim. Acta
266,
51-61
|
| 58.
|
Kornfeld, S.,
and Sly, W. S.
(1985)
Hosp. Pract.
20,
71-75, 78-82
|
| 59.
|
Azuma, N.,
O'Brien, J. S.,
Moser, H. W.,
and Kishimoto, Y.
(1994)
Arch. Biochem. Biophys.
311,
354-357
|
| 60.
|
Potier, M.,
Lamontagne, S.,
Michaud, L.,
and Tranchemontagne, J.
(1990)
Biochem. Biophys. Res. Commun.
173,
449-456
|
| 61.
|
Vaccaro, A. M.,
Salvioli, R.,
Tatti, M.,
and Ciaffoni, F.
(1999)
Neurochem. Res.
24,
307-314
|
| 62.
|
Munford, R. S.,
Sheppard, P. O.,
and O'Hara, P. J.
(1995)
J. Lipid Res.
36,
1653-1663
|
| 63.
|
Johansson, J.,
Curstedt, T.,
and Jornvall, H.
(1991)
Biochemistry
30,
6917-6921
|
| 64.
|
Leippe, M.,
Tannich, E.,
Nickel, R.,
van der Goot, G.,
Pattus, F.,
Horstmann, R. D.,
and Muller-Eberhard, H. J.
(1992)
EMBO J.
11,
3501-3506
|
| 65.
|
Lynch, E. C.,
Rosenberg, I. M.,
and Gitler, C.
(1982)
EMBO J.
1,
801-804
|
| 66.
|
Andersson, M.,
Gunne, H.,
Agerberth, B.,
Boman, A.,
Bergman, T.,
Sillard, R.,
Jornvall, H.,
Mutt, V.,
Olsson, B.,
Wigzell, H.,
Dagerlind, A.,
Boman, H. G.,
and Gudmundsson, G. H.
(1995)
EMBO J.
14,
1615-1625
|
| 67.
|
Ponting, C. P.
(1994)
Protein Sci.
3,
359-361
|
| 68.
|
Hagen, F. S.,
Grant, F. J.,
Kuijper, J. L.,
Slaughter, C. A.,
Moomaw, C. R.,
Orth, K.,
O'Hara, P. J.,
and Munford, R. S.
(1991)
Biochemistry
30,
8415-8423
|
| 69.
|
Guruprasad, K.,
Tormakangas, K.,
Kervinen, J.,
and Blundell, T. L.
(1994)
FEBS Lett.
352,
131-136
|
| 70.
|
Ponting, C. P.,
and Russell, R. B.
(1995)
Trends Biochem. Sci.
20,
179-180
|
| 71.
|
Futerman, A. H.,
Stieger, B.,
Hubbard, A. L.,
and Pagano, R. E.
(1990)
J. Biol. Chem.
265,
8650-8657
|
| 72.
|
Lefrancois, S.,
Michaud, L.,
Potier, M.,
Igdoura, S.,
and Morales, C. R.
(1999)
J. Lipid Res.
40,
1593-1603
|
| 73.
|
Mays, R. W.,
Siemers, K. A.,
Fritz, B. A.,
Lowe, A. W.,
van Meer, G.,
and Nelson, W. J.
(1995)
J. Cell Biol.
130,
1105-1115
|
| 74.
|
Luberto, C.,
and Hannun, Y. A.
(1998)
J. Biol. Chem.
273,
14550-14559
|
| 75.
|
Kornfeld, S.,
and Mellman, I.
(1989)
Annu. Rev. Cell Biol.
5,
483-525
|
| 76.
|
Molkentin, J. D.,
Black, B. L.,
Martin, J. F.,
and Olson, E. N.
(1995)
Cell
83,
1125-1136
|
Copyright © 2000 by The American Society for Biochemistry and Molecular Biology, Inc.

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
This article has been cited by other articles:

|
 |

|
 |
 
V. Seyrantepe, M. Canuel, S. Carpentier, K. Landry, S. Durand, F. Liang, J. Zeng, A. Caqueret, R. A. Gravel, S. Marchesini, et al.
Mice deficient in Neu4 sialidase exhibit abnormal ganglioside catabolism and lysosomal storage
Hum. Mol. Genet.,
June 1, 2008;
17(11):
1556 - 1568.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Y. Sun, D. P. Witte, M. Zamzow, H. Ran, B. Quinn, J. Matsuda, and G. A. Grabowski
Combined saposin C and D deficiencies in mice lead to a neuronopathic phenotype, glucosylceramide and {alpha}-hydroxy ceramide accumulation, and altered prosaposin trafficking
Hum. Mol. Genet.,
April 15, 2007;
16(8):
957 - 971.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
X. Madriz, M. B. Martinez, M. A. Rodriguez, G. Sierra, C. Martinez-Lopez, A. M. Riveron, L. Flores, and E. Orozco
Expression in fibroblasts and in live animals of Entamoeba histolytica polypeptides EhCP112 and EhADH112
Microbiology,
May 1, 2004;
150(5):
1251 - 1260.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
D. Zhou, C. Cantu III, Y. Sagiv, N. Schrantz, A. B. Kulkarni, X. Qi, D. J. Mahuran, C. R. Morales, G. A. Grabowski, K. Benlagha, et al.
Editing of CD1d-Bound Lipid Antigens by Endosomal Lipid Transfer Proteins
Science,
January 23, 2004;
303(5657):
523 - 527.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Lefrancois, T. May, C. Knight, D. Bourbeau, and C. R. Morales
The Lysosomal Transport of Prosaposin Requires the Conditional Interaction of Its Highly Conserved D Domain with Sphingomyelin
J. Biol. Chem.,
May 3, 2002;
277(19):
17188 - 17199.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. Piatigorsky, B. Norman, L. J. Dishaw, L. Kos, J. Horwitz, P. J. Steinbach, and Z. Kozmik
J3-crystallin of the jellyfish lens: Similarity to saposins
PNAS,
October 23, 2001;
98(22):
12362 - 12367.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
H. Hulkova, M. Cervenkova, J. Ledvinova, M. Tochackova, M. Hrebicek, H. Poupetova, A. Befekadu, L. Berna, B.C. Paton, K. Harzer, et al.
A novel mutation in the coding region of the prosaposin gene leads to a complete deficiency of prosaposin and saposins, and is associated with a complex sphingolipidosis dominated by lactosylceramide accumulation
Hum. Mol. Genet.,
April 1, 2001;
10(9):
927 - 940.
[Abstract]
[Full Text]
[PDF]
|
 |
|
Copyright © 2000 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|