Advertisement
JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Originally published In Press as doi:10.1074/jbc.M003497200 on May 18, 2000

J. Biol. Chem., Vol. 275, Issue 32, 24829-24839, August 11, 2000
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
275/32/24829    most recent
M003497200v1
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zhao, Q.
Right arrow Articles by Morales, C. R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zhao, Q.
Right arrow Articles by Morales, C. R.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Identification of a Novel Sequence Involved in Lysosomal Sorting of the Sphingolipid Activator Protein Prosaposin*

Qing Zhao and Carlos R. MoralesDagger

From the Department of Anatomy and Cell Biology, McGill University, Montreal, Quebec H3A 2B2, Canada

Received for publication, April 25, 2000

    ABSTRACT
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Prosaposin is synthesized as a 53-kDa protein, post-translationally modified to a 65-kDa form and further glycosylated to a 70-kDa secretory product. The 65-kDa protein is associated to Golgi membranes and is targeted to lysosomes, where four smaller nonenzymatic saposins implicated in the hydrolysis of sphingolipids are generated by its partial proteolysis. The targeting of the 65-kDa protein to lysosomes is not mediated by the mannose 6-phosphate receptor. The Golgi apparatus appears to accomplish the molecular sorting of the 65-kDa prosaposin by decoding a signal from its amino acid backbone. This investigation deals with the characterization of the sequence involved in this process by deleting the saposin functional domains A, B, C, and D and the highly conserved N and C termini of prosaposin. The truncated cDNAs were subcloned into expression vectors and transfected to COS-7 cells. The destination of the mutated proteins was assessed by immunocytochemistry. Deletion of the C terminus did not interfere with the secretion of prosaposin but abolished its transport to lysosomes. Deletion of saposins and the N-terminal domain did not affect the lysosomal or secretory routing of prosaposin. A chimeric construct of albumin and the C terminus of prosaposin was not directed to lysosomes. However, albumin connected to the C terminus and one or more functional domains of prosaposin reached lysosomes, indicating that the C terminus and at least one saposin domain are required for this process. In summary, we are reporting a novel sequence involved in the targeting of prosaposin to lysosomes.

    INTRODUCTION
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Prosaposin is a 65-kDa protein that is proteolytically cleaved in the lysosomes into four smaller active peptides, known as saposin A, B, C, and D (1, 2). Saposins are detergent-like proteins required for the hydrolysis of glycosphingolipids by specific hydrolases (2, 3). Glycosphingolipids are components of the plasma membrane of eukaryotic cells (4-6), which are degraded in the lysosomal compartment after their endocytosis (7). Saposins A and C stimulate the hydrolysis of glucosylceramide by beta -glucosylceramidase and galactosylceramide by beta -galactosylceramidase (1, 3, 8, 9). Saposin B is the activator of arylsulfatase A, alpha -galactosidase, and beta -galactosidase (10, 11). Saposin D was initially thought to be a sphingomyelinase activator (12), but it is now accepted that it stimulates the degradation of ceramide (13). The physiological importance of saposins has been demonstrated in lysosomal disorders related to the deficiency of a particular saposin causing accumulation of undigested glycosphingolipids within cells. Lack of saposin B has been related to a variant form of metachromatic leukodystrophy (14, 15), and the deficiency of saposin C has been linked to a variant form of Gaucher's disease (16). No lysosomal disorders have been reported due to deficiencies of saposin A or D. However, a genetic disease caused by the complete absence of prosaposin in humans (17) and a genetic deficiency caused by the inactivation of the prosaposin gene in mutant homozygous mice (18) resulted in multiple glycolipid elevation, including lactosylceramidosis with normal sphingomyelinase activity.

Prosaposin also exists as a 70-kDa secretory protein found in several biological fluids such as cerebrospinal fluid, milk, seminiferous tubule fluid, and pancreatic secretion (19-21). The function of the 70-kDa protein is currently under investigation. Nevertheless, secretory prosaposin has been implicated as a glycolipid transfer protein (22, 23) and as a neurotrophic factor (24). In Schwann cells, prosaposin has been found to activate the mitogen-activated protein kinase signaling pathway through a putative G-protein-coupled receptor that is essential for enhanced sulfatide synthesis (25) and to promote cell survival through the phosphatidylinositol 3-kinase/Akt pathway (26).

The 70-kDa secretory prosaposin is a post-translationally modified form of the 65-kDa lysosomal prosaposin (27, 28). This observation suggests that the Golgi apparatus must decode a sorting signal from the 65-kDa prosaposin to target it to the lysosomes before it is fully glycosylated in the distal compartment of this organelle.

Lysosomal proteins use multiple targeting pathways: 1) delivery of soluble hydrolases from the Golgi apparatus to late endosomes via the mannose 6-phosphate receptor (29); 2) delivery of lysosomal membrane proteins such as lysosomal acid phosphatase, lysosomal integral membrane protein I, and lysosomal endosomal protein 100 by transport through the endocytic pathway to endosomes and lysosomes (30-32); and 3) delivery of membrane proteins such as lysosomal associated membrane protein (32) and lysosomal integral membrane protein II (33) from the trans-Golgi apparatus to endosomes and lysosomes. A minor pathway may route lysosomal associated membrane proteins to the lysosomes via the plasma membrane (34). Lysosomal targeting of lysosomal associated membrane protein and lysosomal integral membrane protein I depends on a critical tyrosine-based motif, and lysosomal integral membrane protein II targeting depends on a dileucine-based sorting determinant present in 10-20 amino acids of their long cytoplasmic domains (35-39).

Prosaposin reaches lysosomes by a mannose 6-phosphate-independent mechanism that does not require glycosylation (40-43). Cultured human fibroblasts from human patients with I-cell disease, which fail to phosphorylate mannose residues on newly synthesized lysosomal proteins have nearly normal levels of prosaposin and saposins in the lysosomes (43, 44).

To identify the sequence responsible for the lysosomal routing of prosaposin, deletions of different domains within this protein were done. We observed that residues 521-557 of the C terminus and at least one saposin domain are necessary for the sorting and targeting of prosaposin to lysosomes.

    EXPERIMENTAL PROCEDURES
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Materials-- All restriction enzymes and modifying enzymes were purchased from Amersham Pharmacia Biotech, Promega (Madison, WI), Roche Molecular Biochemicals, Life Technologies, Inc., and Stratagene (La Jolla, CA). The pcDNA3.1B vector was bought from Invitrogen (Carlsbad, CA). The albumin cDNA clone was purchased from ATCC (Manassas, VA). Pepstatin A (isovaleryl-Val-Val-Sta-Ala-Sta) and phenylmethylsulfonyl fluoride were purchased from Sigma. Aprotinin, leupeptin, and (+)-brefeldin A (BFA)1 were from Calbiochem. Endoglycosidase H (Endo H) was from Roche Molecular Biochemicals. Dulbecco's modified eagle medium (DMEM), fetal bovine serum, and trypsin were bought from Life Technologies, Inc. DMEM without methionine and cystine and L-glutamine, L-methionine, L-glutamine, and cysteine were purchased from Sigma-Aldrich. Nu-Serum V culture was from Becton Dickinson Labware (Bedford, MA). ECL, Hybond nylon membrane was purchased from Amersham Pharmacia Biotech. Bovine serum albumin was from Roche Molecular Biochemicals, and Kodak X-Omat films were from Eastman Kodak Co. (Rochester, NY). Tran35S-label was bought from ICN (Irvine, CA). Lowicryl K4M was obtained from MecaLab (Montreal, Canada). LysoTracker Red DND-99 was purchased from Molecular Probes, Inc. (Eugene, OR).

Antibodies-- Anti-procathepsin B polyclonal antibody was a gift from Dr. John Mort (Shriner Hospital, McGill University). Mannosidase II polyclonal antibody was kindly provided by Dr. Marilyn Farquhar (Yale University). Anti-Myc monoclonal antibody was purchased from Invitrogen (Carlsbad, CA). Anti-prosaposin polyclonal antibody was a gift from Dr. Michael D. Griswold (Washington State University). Anti-mouse IgG1 conjugated to agarose, protein A conjugated to agarose, goat anti-mouse IgG conjugated to fluorescein isothiocyanate (FITC), goat anti-rabbit IgG conjugated to tetramethylrhodamine isothiocyanate, and peroxidase-conjugated goat anti-rabbit antibody were bought from Sigma-Aldrich. Goat anti-mouse IgG conjugated to 10-nm colloidal gold particles and goat anti-rabbit IgG conjugated to 15-nm colloidal gold particles were purchased from Cedarlane (Hornby, Canada).

Recombinant cDNA Constructs-- A full-length prosaposin cDNA was obtained by screening a mouse testicular cDNA library (Stratagene, CA). Briefly, a PCR-amplified DNA fragment was labeled with 32P and used as a probe (46). An aliquot containing 1 million recombinants was screened after transferring the plaques onto nitrocellulose membranes and by hybridizing them with the radioactive probe. Purified positive phages were grown, and the pBluescript plasmid containing the insert was excised from the phage according to the manufacturer's instructions. A full-length 2.6-kb prosaposin cDNA in the plasmid was confirmed after sequencing both DNA strands and used as a template for the different constructs made during this study. The fidelity of individual constructs was confirmed by restriction mapping and DNA sequencing (Sheldon Facility Center, McGill University)

Pro-WT is the wild type prosaposin cDNA subcloned into a mammalian expression vector pcDNA3.1B. A pair of primers, Fc (5'-cgccaccatgtacgccctcgccctc-3') and Rc (5'-ggaattccacacatggcgtttgcaat-3'), was used to amplify a 1.6-kb fragment consisting of the whole open reading frame of prosaposin by PCR with vent DNA polymerase. A Kozak sequence CGCCACC was added to primer Fc at the 5'-end. An EcoRI restriction site was added to the 5'-end of primer Rc for suitable subcloning. The pcDNA3.1B vector was digested with BamHI and filled in with a Klenow fragment to create a blunt end. The vector was then digested with EcoRI and purified, and the DNA concentration was estimated. PCR fragments were digested with EcoRI restriction enzyme, purified, and subcloned into the prepared pcDNA3.1B vector. The resulting plasmid was designated Pro-WT.

Delta N-term and Delta C-term are prosaposin constructs lacking part of the N terminus (residues 17-59) and C terminus (residues 520-556). For the Delta N-term truncated construct, part of its N-terminal region in front of the domain for saposin A was eliminated. An upstream primer Nf (5'-agccctgtctcccttccttgcgacata-3') and downstream primer Nr (5'-aggaagggagacagggctggtcagag-3') were designed according to the sequence of prosaposin cDNA. Two pairs of primers, Fc/Nr and Nf/Rc, were used in the first run of PCR. Fc/Rc primers were utilized in the second run of PCR using amplified Fc/Nr fragment and Nf/Rc fragment as templates. PCR fragment (1.6 kb) was digested by EcoRI restriction enzyme and purified before subcloning into the prepared pcDNA3.1B vector. The resulting plasmid construct was called Delta N-term.

For the Delta C-term truncated construct, the same upstream Fc primer and a new downstream primer COOHr (5'-ggaattcttataggcagaaggggcaa-3') were used to omit a sequence (LLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN) encoding the C terminus after the saposin D domain and subcloned into pcDNA3.1B vector.

Delta A (residues 57-147), Delta B (residues 189-278), Delta C (residues 309-396), and Delta D (residues 434-522) mutant plasmids are prosaposin constructs lacking individual saposin functional domains. Three pairs of primers were used for each construct. The external primers Fc/Rc were the same as for the Pro-WT construct. The two internal primers were Af (5'-acagcgaaatacttggccgagcaaaac-3') and Ar (5'-ggccaagtatttcgctgtgggcttg-3') for Delta A; primers Bf (5'-caacctaagccgagagtgccaatgaag-3') and Br (5'-cactctcttcttaggttggggctggct-3') for Delta B; primers Cf (5'-caggcccacgagttggtggaggcactt-3') and Cr (5'-caccaactcgtgggcctggaccagat-3') for Delta C; and primers Df (5'-cctcagaagctgctgctgggaaccga-3') and Dr (5'-cagcagcagcttctgaggaggcacatg-3') for Delta D. All of these primers were backwards to each other. The pairs of primers Fc/Ar and Af/Rc, Fc/Br and Bf/Rc, Fc/Cr and Cf/Rc, and Fc/Dr and Df/Rc were used in the first run of PCR for Delta A, Delta B, Delta C, and Delta D constructs, respectively. Primers Fc/Rc were used in the second run of PCR using the amplified Fc/Ar and Af/Rc fragments, Fc/Br and Bf/Rc fragments, Fc/Cr and Cf/Rc fragments, and Fc/Dr and Df/Rc fragments as templates for each construct. The final PCR products were purified and digested with EcoRI and then subcloned into the prepared pcDNA3.1 B vector.

Alb/Pro-c-term, Alb/(Pro-D+Pro-c-term), Alb/(Pro-C,D+Pro-c-term), and Alb-WT Constructs-- The first three fusion protein constructs contain the full-length albumin and partial prosaposin sequences, i.e. the C terminus of prosaposin (Alb/Pro-c-term), the domain D plus the C terminus of prosaposin (Alb/Pro-D+Pro-c-term), and the domains C and D plus the C terminus of prosaposin (Alb/Pro-C,D+Pro-c-term). Alb-WT is wild type albumin. Three pairs of primers were used in each of the chimeric constructs except in the wild type albumin, which had one pair of primers (Alb-F/Alb-R) prepared according to the nucleotide sequence of albumin. Primers Alb-F (5'-cgccaccatgaagtgggtaacctttatttc-3') R-alb (5'-cagcagcagccctaaggcagcttgactt-3'), F-alb (5'-gccttagggctgctgctgggaaccga-3') and Rc were used for Alb/Pro-c-term. Primers Alb-F, Dcooh-R (5'-cccaccattccctaaggcagcttgactt-3'), Dcooh-F (5'-gccttagggaatggtgggttctgtgag-3'), and Rc were used for chimera Alb/(Pro-D+Pro-c-term). Primers Alb-F, CDcooh-F (5'-gccttagggaatctggtccaggcccac-3'), CDcooh-R (5'-gaccagattccctaaggcagcttgactt-3'), and Rc were used for chimeric construct Alb/(Pro-C,D+Pro-c-term). The pair of primers Alb-F/R-alb and F-alb/Rc were used for chimeric construct Alb/(Pro-c-term); primers Alb-F/Dcooh-R and Dcooh-F/Rc were used for chimeric construct Alb/(Pro-D+Pro-c-term); and primers Alb-F/CDcooh-R and CDcooh-F/Rc were used for chimeric construct Alb/(Pro-C, D+Pro-c-term) in the first PCR run. The amplified two fragments of each construct were mixed and used as templates in the second run of PCR with the same pair of primer Alb-F/Rc. Alb-F and Alb-R (5'-ggaattccctaaggcagcttgactt-3') were the primers used for amplification of the wild type albumin (1.8 kb). Final PCR products were purified and digested with EcoRI restriction enzyme and subcloned into the same pcDNA3.1B vector.

Cell Culture and Transfections-- COS-7 cells were maintained in DMEM supplemented with 10% fetal bovine serum, 100 units/ml penicillin, and 100 µg/ml streptomycin in an atmosphere of 5% CO2 at 37 °C. Cells (60% confluence) grown on coverslips (12 mm in diameter) in six-well dishes were transfected with LipofectAMINE according to the manufacturer's instruction. Cells grown in 100-mm Petri dishes were transfected according to the DEAE-dextran method (76). Briefly, COS-7 cells (5 × 105) were seeded into DMEM containing 10% Nu-Serum overnight. 5 µg of plasmid DNA was mixed with 40 µl of 5% DEAE-dextran, 5 µl of 0.1 M chloroquine phosphate in 5 ml of DMEM with 10% Nu-Serum for 4 h. Cells were shocked with 10% Me2SO for 1 min, rinsed with PBS, and replaced with DMEM containing 10% fetal bovine serum for at least 48 h.

Metabolic Labeling, Immunoprecipitation, and Endo H Digestion-- Cells were washed twice with PBS after 48 h of transfection with different plasmid constructs and starved for 1 h in starvation medium (DMEM lacking methionine and cysteine but containing 5% dialyzed fetal bovine serum and 200 mM glutamine). Cells were then pulsed in starvation medium supplemented with Tran35S-label (300 µCi/ml) for the times indicated. For experiments including chase periods, the radiolabeled medium was removed, and cells were washed twice with PBS and incubated with cell growth medium supplemented with unlabeled methionine (1.5 mg/ml) and cysteine (2.4 mg/ml) for the chase time indicated. When specified, cells were incubated with brefeldin A (20 µg/ml) for 1 h prior to the addition of medium containing the radiolabeled and fresh brefeldin A.

Monolayers of cells and media were collected. Cells were lysed with 1× lysis buffer (1% Triton X-100, 150 mM NaCl, 10 mM Tris, pH 7.4, 1 mM EDTA, 1 mM EGTA, pH 8.0, 0.2 mM sodium orthovanadate, 2 mM phenylmethylsulfonyl fluoride, 0.5% Nonidet P-40, 10 µg/ml pepstatin A, 10 µg/ml aprotinin, 10 mg/ml leupeptin). After treating with primary anti-Myc antibody or anti-prosaposin antibodies bound to anti-mouse IgG-agarose or protein A-agarose, the immunoprecipitates were washed three times with 1× lysis buffer. Samples were then resolved by SDS-PAGE, and radioactive signals were visualized by fluorography. A 15% Tricine-SDS-PAGE was performed to resolve smaller molecular weight proteins.

To digest the immunoprecipitates with endoglycosidase H, they were released from agarose and antibodies first, by boiling in 50 µl of 1% SDS and 200 mM dithiothreitol for 5 min. An equal volume of 100 mM citric acid buffer (pH 5.5) and 1 unit of endoglycosidase H was added to the immunoprecipitates and incubated at 37 °C for 16 h. The processed samples were resolved by 10% SDS-PAGE and detected by fluorography.

Immunofluorescent and LysoTracker Staining and Confocal Microscopy-- For immunofluorescent staining, the cells transfected with the wild type and mutated constructs were fixed with 3.8% paraformaldehyde in 0.1 M phosphate buffer (pH 7.2) at room temperature and washed with PBS. Cells were permeabilized with 0.5% Triton X-100 in PBS for 30 min at room temperature and then blocked with 10% goat serum in PBS for 1 h. After washing with PBS, the cells were incubated with monoclonal antibody against Myc (1:100) and polyclonal antibody against mannosidase II (1:500) at 4 °C overnight. Following three washes in 0.05% Tween 20 in PBS, cells were incubated with a 1:100 dilution of FITC-conjugated goat anti-mouse and tetramethylrhodamine isothiocyanate-conjugated goat anti-rabbit secondary antibodies. After three washes in 0.05% Tween 20 in PBS, the cells were rinsed with double distilled H2O. Subsequently, the coverslips were mounted on slides using Mowiol (Calbiochem). Staining of acidic compartments was done on live COS-7 cells grown on coverslips by adding LysoTracker (50 nM) to culture medium for 30 min at 37 °C, followed by incubation in normal medium without LysoTracker for 15 min. Cells were then immunostained as depicted above. Cells were examined with a Zeiss Axiovert confocal microscope with a ×63 objective and the appropriate filter set. Fluorescent images were then resized using Adobe Photoshop.

Immunogold Labeling-- After 48 h of transfection with different plasmid constructs, cells were detached from the culture dishes with 0.1% trypsin in Hanks' balanced salt solution. The cells were pelleted and fixed with 4% paraformaldehyde and 0.5% glutaraldehyde in 0.05 M phosphate buffer. The cell pellets were dehydrated in methanol and embedded in Lowicryl K11M as described previously by Sylvester et al. (54).

Ultrathin Lowicryl sections were mounted on 300-mesh Formvar-coated nickel grids (Polyscience Inc., Warrington, PA). Each section was then floated for 15 min on a drop of 20 mM Tris-HCl-buffered saline (TBS) containing 15% (v/v) goat serum and then incubated for 30 min on a drop of anti-Myc monoclonal antibody diluted 1:50 in TBS. The sections were then washed in TBS containing 0.05% Tween 20. After blocking again with 15% goat serum, the sections were incubated with 10-nm colloidal gold-conjugated goat anti-mouse IgG. For double staining with a lysosomal marker, sections were blocked and incubated with a procathepsin B antibody (1:50) as described above. A 15-nm colloidal gold-conjugated goat anti-rabbit secondary antibody was used. Sections were counterstained with uranyl acetate in 30% ethanol (2 min) followed by lead citrate (30 s). Normal rabbit serum served as control. Electron micrographs were taken on a Philips 400 electron microscope.

Western Blotting-- After 48 h of transfection with different plasmid constructs, cells were rinsed twice with cold PBS, lysed with 1× sample buffer (125 mM Tris, pH 6.8, 2% SDS, 5% glycerol, 1% beta -mecaptoethanol), and boiled for 5 min. 50 µg of total protein were loaded and resolved in 10% SDS-PAGE gel and transferred to 0.45-µm nitrocellulose membranes. Membranes were blocked in 5% skimmed milk in TBS and probed with anti-Myc antibody, followed by incubation with secondary antibody, horseradish peroxidase conjugated to goat anti-mouse IgG. The membranes were developed by ECL and exposed to x-ray films.

    RESULTS
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Analysis of Prosaposin Domains-- Alignment of amino acid residues for saposins as well as the N and C termini of prosaposin showed a similarity of 70-90% among different species (2, 3, 45, 46). Each saposin contains 80 amino acids, 6 conserved cysteine residues that form three internal disulfide bonds, an N-glycosylation site, a conserved proline residue, and 14 or 15 hydrophobic amino acid residues at the same position (46). Alignment between the N (residues 1-60) and C termini (residues 521-557) of prosaposin showed a 40% identity and 66% similarity. A GenBankTM data base search revealed a 70% similarity between 29 amino acids of the N terminus of the human surfactant protein B (SP-B) and the C terminus of prosaposin. This surfactant protein B sequence is involved in the transport of this protein to the lamellar bodies of pneumocyte type II (47). A unique characteristic of the lysosomal nature of lamellar bodies is the content of hydrolases and a lysosomal membrane glycoprotein (48, 49).

Deletion of Prosaposin Functional Domains-- Based on the analysis of prosaposin, saposin functional domains A, B, C, and D and the N and C termini of prosaposin were deleted. The truncated constructs were designated Delta A, Delta B, Delta C, Delta D, Delta N-term, and Delta C-term to indicate the deleted region of the protein. Wild type prosaposin was designated Pro-WT (Fig. 1A). The constructs were subcloned into a mammalian expression vector, pcDNA3.1B, which harbors a Myc epitope tag before the stop codon. Pro-WT and all truncated mutants were transiently transfected into COS-7 cells. The intracellular distribution of the constructs was assessed by immunofluorescent staining with primary anti-Myc monoclonal antibody and secondary FITC-conjugated goat anti-mouse antibody.


View larger version (22K):
[in this window]
[in a new window]
 
Fig. 1.   Effect of truncation on the lysosomal transport of prosaposin. A, schematic representation of wild type and truncated prosaposin constructs subcloned into the pcDNA3.1B expression vector. Pro-WT is the wild type prosaposin containing the full-length cDNA of prosaposin encoding the N terminus (N-term), the saposin A, B, C, and D domains, and the C terminus (C-term). The truncated constructs were designated Delta N-term (deletion of residues 17-59), Delta A (deletion of residues 57-147), Delta B (deletion of residues 189-278), Delta C (deletion of residues 309-396), Delta D (deletion of residues 404-522), and Delta C-term (deletion of residues 520-556) to indicate the specific regions deleted from prosaposin (shown by dotted lines). B, expression of wild type and truncated prosaposins after transfection into COS-7 cells. Approximately 50 µg of whole cell lysates were subjected to a 10% SDS-PAGE, transferred onto a nylon membrane, and immunoblotted with anti-Myc monoclonal antibody. Two bands representing the 65- and 70-kDa wild type prosaposins (WT) are indicated in the membrane. Mutants (Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term) also produced two slightly lower bands depending on the size of the truncated sequences. Nontransfected COS-7 cells (COS-7) and COS-7 cells transfected with the vector alone (V) were used as negative controls. C, immunofluorescent staining of COS-7 cells after transfection with expression vectors containing wild type (Pro-WT) and truncated prosaposin (Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term). Primary anti-Myc monoclonal antibody was visualized with a FITC-conjugated goat anti-mouse antibody. Pro-WT (WT) and the mutant constructs Delta N-term, Delta A, Delta B, Delta C, and Delta D yielded Golgi-like perinuclear and granular reactions. Cells transfected with Delta C-term show a Golgi-like perinuclear staining, but the granular reaction is seemingly absent.

The two forms of wild type prosaposin (i.e. the 65-kDa lysosomal form and the 70-kDa secretory form) were found by Western blot analysis with antibody against Myc in Pro-WT (Fig. 1B). All mutants also produced the two forms of prosaposin with lower molecular weights due to the truncation of their corresponding domains (Fig. 1B). Confocal immunofluorescence of COS-7 cells transfected with wild type prosaposin Pro-WT and Delta A, Delta B, Delta C, Delta D, and Delta N-term mutants with Myc antibody yielded both a perinuclear and a granular reaction. Cells transfected with the Delta C-term mutant did not yield any granular staining, but the reaction persisted in the perinuclear region (Fig. 1C).

To confirm whether the granular structures observed in Pro-WT and Delta A, Delta B, Delta C, Delta D, and Delta N-term were lysosomes, the lysosomal marker LysoTracker was used as a probe. This marker is sensitive to low pH and stains all acidic vesicles including the trans-Golgi region. The LysoTracker (red fluorescence) showed overlap with the punctate structures stained with Myc antibody (green fluorescence) in Pro-WT, Delta A, Delta B, Delta C, Delta D and Delta N-term (Fig. 2A). In Delta C-term mutant, although the LysoTracker detected numerous lysosomes, Myc antibody staining was negative in these granules (Fig. 2A).


View larger version (20K):
[in this window]
[in a new window]
 
Fig. 2.   Localization of wild type and truncated prosaposin in COS-7 cells. A, colocalization of wild type and truncated prosaposins after immunostaining with anti-Myc antibody and LysoTracker (red fluorescence) overlapped with punctate structures stained with anti-Myc monoclonal antibody (green fluorescence). A partial overlap was detected on a Golgi-like perinuclear region in wild type, Pro-WT (WT), and Delta N-term, Delta A, Delta B, Delta C, and Delta D mutants. No overlap of punctate structures stained by LysoTracker was found in Delta C-term mutant due to the absence of granular staining with anti-Myc antibody. B, colocalization of Delta C-term mutant and mannosidase II. Anti-mannosidase II polyclonal antibody was used as a Golgi marker and visualized with a tetramethylrhodamine isothiocyanate-conjugated goat anti-rabbit antibody. Delta C-term mutant was stained with anti-Myc monoclonal antibody and visualized with a FITC-conjugated goat anti-mouse antibody. An overlap between the Myc (green fluorescence) and mannosidase II (red fluorescence) antibodies was observed in a Golgi-like perinuclear region of COS-7 cells transfected with the Delta C-term construct. This result demonstrated that prosaposin mutations did not affect the transit of the truncated protein from the ER to the Golgi apparatus.

Since the Myc antibody yielded a perinuclear reaction reminiscent of the Golgi apparatus in all of the constructs including the Delta C-term mutant, an anti-mannosidase II antibody was used as a Golgi marker. Confocal immunostaining revealed an overlap between the two antibodies in all constructs, including in the Delta C-term mutant (Fig. 2B).

To further confirm the immunofluorescence results, a double immunogold labeling was conducted on COS-7 cells transfected with the Pro-WT, Delta A, Delta B, Delta C, Delta D, Delta C-term, and Delta N-term constructs and analyzed by electron microscopy. To accomplish this objective, goat anti-mouse IgG conjugated to 10-nm gold was used to detect the monoclonal Myc antibody, and goat anti-rabbit IgG conjugated to 15-nm gold was used to detect the rabbit procathepsin B antibody. The results showed a strong labeling with 10-nm gold particles and a weak labeling with the 15-nm gold particles of electron-dense membrane-bound structures in COS-7 cells transfected with the Pro-WT, Delta A, Delta B, Delta C, Delta D, and Delta N-term (Fig. 3). These structures were considered to be lysosomes. However, in cells transfected with the Delta C-term construct, no labeling was found with anti-Myc antibody in the lysosomes.


View larger version (119K):
[in this window]
[in a new window]
 
Fig. 3.   Immunogold labeling of COS-7 cells transfected with Pro-WT (WT), Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term constructs. Goat anti-mouse IgG conjugated to 10-nm gold particles was used to detect monoclonal Myc antibody. Goat anti-rabbit IgG conjugated to 15-nm gold particles (circled) was employed to detect polyclonal procathepsin B antibody used as a lysosomal marker. A strong immunogold labeling with 10-nm gold particles and weak immunogold labeling with 15-nm gold particles were observed within the lysosomes of COS-7 cells transfected with the Pro-WT, Delta N-term, Delta A, Delta B, Delta C, and Delta D constructs. No labeling with anti-Myc antibody was found in the lysosomes of COS-7 cells transfected with Delta C-term mutant. Negative control (con) was immunogold-labeled in the absence of the primary antibodies.

Metabolic Labeling Study-- To study the biosynthetic processing of the wild type and truncated prosaposin in vivo, to examine whether they were properly folded within the endoplasmic reticulum (ER) and therefore transported to their destinations, pulse-chase experiments were conducted using Tran35S-label. COS-7 cells transfected with pcDNA3.1B vector alone or containing the Pro-WT and the truncated constructs were incubated with Tran35S-label for 30 min and chased for 30 min and 2 h. Cell lysates and samples from the medium were immunoprecipitated with anti-Myc antibody and then subjected to SDS-polyacrylamide gel electrophoresis and fluorography. As shown in Fig. 4A, the 65-kDa form was visualized after 30 min in Pro-WT and in each of the truncated mutants including the Delta C-term. After chasing for 2 h, the amount of 65-kDa protein decreased in cell lysates, while the 70-kDa secretory protein increased in the spent media. In the mutants, the equivalents of the 65- and 70-kDa proteins were slightly smaller due to their truncation. In the case of the Delta C-term mutant, the increase of the secretory form in the medium was more prominent as confirmed by densitometry (Fig. 4B). These data suggest that cells transfected with the Pro-WT and the truncated mutants including Delta C-term produced properly folded proteins within the ER and that the transport to the Golgi apparatus and secretion in the media was not altered.


View larger version (38K):
[in this window]
[in a new window]
 
Fig. 4.   Effect of truncation on the synthesis, targeting, and processing of prosaposin. A, pulse-chase analysis of COS-7 cells transfected with pcDNA3.1B alone (V) or with the same vector containing Pro-WT (WT) and truncated constructs Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term. Cells were pulsed with Tran35S-label (300 µci/ml) for 30 min and chased for 2 h and 30 min. Cell lysates and culture medium were immunoprecipitated with anti-Myc antibody and subjected to 10% SDS-PAGE and fluorographed. A, both the 70- and 65-kDa prosaposins were present intracellularly. B, in the medium, only the 70-kDa secretory form was present. C, detection of mature saposins in COS-7 cells transfected with Pro-WT and Delta C-term after labeling with Tran35S-label. COS-7 cells transfected with Pro-WT(WT) and Delta C-term were labeled with Tran35S-label (300 µci/ml) for 5 h prior to immunoprecipitation with anti-prosaposin antibody. Immunoprecipitates were subjected to a 15% Tricine-SDS-PAGE followed by fluorography. A 15-kDa band corresponding to saposins was observed in cells transfected with the Pro-WT but absent in cells transfected with the Delta C-term. The major band (65 kDa) in WT and a slightly smaller band in the Delta C-term mutant represent the lysosomal precursor of saposins. COS-7 cells transfected with pcDNA3.1B vector alone were used as negative control.

Although the Delta C-term mutation abolished the transport of prosaposin to the lysosomes, it did not interfere with its secretion. Since the Delta C-term mutant protein did not reach the lysosomes, it was predicted that COS-7 cells transfected with this construct would not yield mature saposins as opposed to cells transfected with the Pro-WT construct. To confirm if this was the case, cells transfected with Delta C-term and Pro-WT were subjected to a longer pulse labeling experiment with Tran35S-label (Fig. 4C) to detect the proteolytically cleaved saposins. After 5 h of labeling, cell lysates were immunoprecipitated with anti-prosaposin antibody, which recognizes both prosaposin and mature lysosomal saposins. The immunoprecipitates were resolved in a 15% Tricine-SDS-PAGE and fluorographed. Wild type 65-70-kDa and Delta C-term slightly smaller prosaposins were detected in cell lysates (Fig. 4C). As expected, mature saposins were not observed in cells transfected with the Delta C-term construct but present in the cells transfected with the Pro-WT construct.

The Addition of Prosaposin Functional Domains to a Secretory Protein-- To determine whether the C terminus alone was sufficient for intracellular targeting, a chimeric protein encoding the full-length cDNA of albumin plus the C terminus of prosaposin (Alb/Pro-c-term) was constructed and subcloned into the pcDNA3.1B vector and transfected into COS-7 cells. Wild type albumin cDNA was also prepared as a control (Alb). Albumin is a secretory protein that reaches the extracellular space by a constitutive secretory pathway. After transfection, cells were immunostained with anti-Myc antibody, followed by a secondary FITC-conjugated goat anti-mouse antibody. Some cells were simultaneously stained with LysoTracker. Myc antibody (green fluorescence) produced a perinuclear Golgi-like reaction (Fig. 5A). However, the punctate structures stained by LysoTracker (red fluorescence) did not react with anti-Myc antibody. This suggested that the C terminus alone was insufficient to drive albumin to lysosomes. Based on this result and on the mutational analysis of prosaposin, it was hypothesized that one or more saposin domains should also be present along with the C terminus to direct albumin to the lysosomes.


View larger version (32K):
[in this window]
[in a new window]
 
Fig. 5.   Expression and targeting of chimeric constructs. A, targeting of chimeric proteins to the lysosomes. A typical Golgi-like reaction (green fluorescence) was observed in COS-7 cells transfected with Alb/Pro-c-term as well as with the wild type albumin (Alb-WT). A Golgi-like reaction plus a prominent lysosome-like staining was achieved with the Alb/(Pro-D+Pro-c-term) and Alb/(Pro-C,D+Pro-c-term) constructs (green fluorescence). LysoTracker staining (red fluorescence) was seen in COS-7 cells transfected with the different constructs. The punctate reaction obtained with anti-Myc (green fluorescence) in Alb/(Pro-D+Pro-c-term) and Alb/(Pro-C, D+Pro-c-term) overlapped with LysoTracker staining (red fluorescence). This experiment demonstrated that the prosaposin domain plus the C terminus are required for the transport of albumin to the lysosomes. B, Western blot analysis of wild type and albumin chimeric proteins. COS-7 cells transfected with wild type albumin (Alb-WT) and chimeric constructs Alb/Pro-c-term, Alb/(Pro-D+Pro-c-term), and Alb/(Pro-C, D+Pro-c-term) were lysed and subjected to a 10% SDS-PAGE, transferred onto a nylon membrane, and immunostained with anti-Myc monoclonal antibody. The molecular mass of wild type albumin (Alb-WT) is indicated by an arrow (66 kDa). Other bands with higher molecular masses correspond to the chimeric proteins.

To test this hypothesis, a chimeric protein was engineered by fusing an albumin cDNA with nucleotide sequences encoding domain D and the C terminus of prosaposin (Alb/Pro-D, c-term). In addition, an albumin fusion protein containing domains C and D plus the C terminus of prosaposin (Alb/Pro-C, D, c-term) was also constructed. Anti-Myc antibody yielded a punctate reaction in both chimeras (Fig. 5A), which overlapped with LysoTracker staining. Western blotting with Myc antibody confirmed the expression of wild type and chimeric albumin proteins (Fig. 5B).

Endo H Treatment of Prosaposin-- The difference between the 65-kDa and 70-kDa prosaposins is due to their glycosylation state (55). To determine the structures of their N-linked carbohydrates and to identify the potential sorting compartment for the lysosomal precursor within the Golgi apparatus, endoglycosidase H digestion was performed on immunoprecipitated proteins. Anti-Myc antibody was used to immunoprecipitate recombinant prosaposins from lysates of COS-7 cells transfected with wild type Pro-WT and mutated constructs. Results revealed that in all cases, the 65-kDa band shifted to a 53-kDa band, which corresponds to the molecular weight of the native form of prosaposin (55). The less prominent protein band corresponding to the 70-kDa protein was resistant to Endo H treatment (Fig. 6A). Similarly, the 70-kDa secretory protein immunoprecipitated from the medium was Endo H-resistant (Fig. 6B). This result suggested that the 65-kDa lysosomal form of prosaposin exits from the cis/medial compartment of the Golgi, while the 70-kDa protein traversed the Golgi apparatus, completing its terminal glycosylation.


View larger version (54K):
[in this window]
[in a new window]
 
Fig. 6.   Treatment with Endo H of COS-7 cells transfected with wild type Pro-WT (WT) and Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term prosaposin constructs. After transfection with Pro-WT and truncated constructs, COS-7 cells were labeled with Tran35S-label (300 µci/ml) for 30 min and chased for 2 h. Cell lysates and culture medium were immunoprecipitated with anti-Myc antibody and incubated with Endo H (1 unit) at 37 °C for 16 h. Immunoprecipitated proteins were resolved in a 10% SDS-PAGE followed by fluorography. A, in cell lysates, the 65-kDa protein band shifted to a 53-kDa band, and the less prominent 70-kDa band remained unchanged (Endo H +). Similar band patterns were also observed with the truncated prosaposins (Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term) with slightly smaller molecular masses due to the truncations. B, in culture medium, the 70-kDa (WT) band, representing the secretory form of prosaposin, was not modified after incubation with Endo H. Similar results were obtained with truncated prosaposins (Delta N-term, Delta A, Delta B, Delta C, Delta D, and Delta C-term). COS-7 cells transfected with the vector alone (Vector) were used as a negative control.

Treatment with BFA-- To verify whether the Golgi apparatus was the site where the 65-kDa lysosomal precursor was sorted, BFA was used prior to Tran35S-labeled pulse-chase experiments. BFA is a fungal metabolite that causes rapid redistribution of the components of the Golgi apparatus to the ER (50, 51). COS-7 cells transfected with the wild type prosaposin (Pro-WT) were incubated with BFA 1 h prior to Tran35S-labeling. In the presence of BFA, the amount of intracellular protein in cell lysates remained unchanged after chasing for 4 h, while in cells not treated with BFA, the amount of protein decreased after chasing for 2 h (Fig. 7). In the medium of cells incubated with BFA, there was a very low amount of the 70-kDa protein after chasing for 30 min, 2 h, and 4 h. This indicated that the 70-kDa secretory protein present before the supplementation of BFA was beyond the proximal compartment of the Golgi apparatus. In contrast, in cells incubated without BFA, the amount of protein in the medium increased after 30 min and 2 h (Fig. 7). Taken together, these data suggest that the 65-kDa lysosomal precursor contains mainly high mannose sugar residues and that it is present in the proximal aspect of the Golgi apparatus. On the other hand, the 70-kDa secretory form is glycosylated with complex/hybrid sugar residues and appear to exit from the distal region of the Golgi apparatus.


View larger version (17K):
[in this window]
[in a new window]
 
Fig. 7.   Pulse-chase of COS-7 cells transfected with Pro-WT treated with BFA. Cells were incubated with BFA (20 µg/ml) (+BFA) 1 h prior to the addition of Tran35S-label (300 µCi/ml). Replicas of COS-7 cells were grown in absence of BFA and used as controls. After labeling for 30 min, cells were chased for an additional 30 min, 2 h, and 4 h. Immunoprecipitates of cell lysates and culture medium were resolved in a 10% SDS-PAGE and fluorographed. BFA caused intracellular retention of the 65-kDa protein. In control cells, the 65-kDa protein decreased intracellularly, while the 70-kDa protein increased in control medium.


    DISCUSSION
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Prosaposin exists as a 65-kDa lysosomal precursor that is routed to the lysosomes and a 70-kDa secretory form that is secreted to the extracellular space (27, 41, 52-54). Time course experiments demonstrated that the 65-kDa form is derived from post-translational modification of a 53-kDa native protein and that is the precursor of the 70 kDa secretory prosaposin (55). Prosaposin is highly conserved from avian to mammals (45, 46). Conserved regions of prosaposin include four saposin domains designated A, B, C, and D (1) and its N and C termini. Little or no conservation exist among the linker regions found between domains A and B, B and C, and C and D (45, 46). In lysosomes, the 65-kDa protein is cleaved into four sphingolipid activator proteins termed saposins A-D, which are essential cofactors for the hydrolysis of glycosphingolipids with short oligosaccharide chains by specific hydrolases (56, 57).

The dichotomy of prosaposin's lysosomal and secretory pathways raises a number of interesting questions such as how a fraction of the 65-kDa protein escapes terminal glycosylation and what is the mechanism utilized by the lysosomal prosaposin to leave the Golgi apparatus.

Prosaposin, unlike most lysosomal hydrolases, is targeted to lysosomes by a mannose 6-independent mechanism (41-43). The transport of soluble hydrolases to lysosomes depends on their mannose 6-phosphate residues that are recognized by the mannose 6-phosphate receptor in the trans-Golgi region (29, 34, 58). The ligand-receptor complex is then carried to lysosomes via a clathrin-coated vesicle. The 65-kDa protein has been shown to be associated with Golgi membranes (41). In vitro assays demonstrated that prosaposin and lysosomal saposins are capable of binding sphingolipids (22, 59, 60). Incubation of cells with tunicamycin did not interfere with the transit of the nonglycosylated 53-kDa form of prosaposin from the ER to the Golgi apparatus nor with its association to Golgi membranes (41). Moreover, as a result of tunicamycin treatment, the nonglycosylated prosaposin was transported to the lysosomes more efficiently (41). This suggested that the sorting and targeting of the 65-kDa prosaposin within the Golgi apparatus might be dependent on a protein-protein or protein-lipid interaction. To test this hypothesis and to determine whether or not a specific domain of prosaposin is involved in this process, a wild type prosaposin cDNA and several truncated constructs were subcloned into a mammalian expression vector and transfected into COS-7 cells. The recombinant constructs contained a Myc epitope tag that allowed their identification from endogenous prosaposin during the course of our immunochemical studies. The lysosomal marker LysoTracker was also used to identify lysosomes by confocal microscopy. Confocal immunofluorescence demonstrated that deletion of individual domains encoding saposin A, B, C, or D or the N terminus did not interfere with the targeting of prosaposin to the lysosomal compartment. On the other hand, deletion of the C terminus abolished the targeting of prosaposin to lysosomes. To check if these deletions caused retention of mutated prosaposin in the ER, COS-7 cells were metabolically labeled with Tran35S-label and chased. Cell lysates and culture medium were immunoprecipitated and fluorographed. The results demonstrated the presence of the equivalent 65- and 70-kDa proteins of prosaposin in the cell lysates and of the 70-kDa secretory protein in the medium. In summary, our results clearly indicated that deletions of the Delta A, Delta B, Delta C, Delta D, Delta N-term, and Delta C-term did not cause retention of prosaposin in the ER and that the presence of the C terminus of prosaposin was essential for the sorting and targeting of prosaposin to the lysosomes.

To verify if the C terminus alone was sufficient for driving prosaposin to the lysosomes, a chimeric fusion protein between albumin and the C terminus of prosaposin was expressed in COS-7 cells using the same vector. A vector containing the cDNA of albumin alone was used as a control. As expected for a secretory protein, wild type albumin was detected in the culture medium. However, chimeric albumin fused with the C terminus of prosaposin was not found within lysosomes. Instead, it was secreted into the culture medium.

We rationalized then that truncated constructs Delta A, Delta B, Delta C, Delta D, and Delta N-term, which were targeted to lysosomes, contained the C terminus and at least three saposins. Since saposins display, among themselves, similar structure and play similar roles in vivo and in vitro, we decided to test the hypothesis that one or more saposin domains plus the C terminus are required for the transport of prosaposin to lysosomes. Thus, two new fusion plasmids were made. The first one was composed of albumin plus domain D and the C terminus of prosaposin. The second construct was made of albumin plus domains C and D and the C terminus of prosaposin. As predicted, confocal immunostaining demonstrated that albumin was routed to the lysosomal compartment when it was connected to one saposin domain plus the C terminus of prosaposin.

Each saposin has a high degree of interspecies similarity of hydrophobic amino acids (45, 46). The percentage of hydrophobic amino acids is 36% in saposin A, 37% in B, 28% in C, and 39% in D (45). This high degree of conservation of hydrophobic residues and their alignment occupying equivalent positions with their side chains buried in the folded structure (46) underlines the capacity of saposins to interact with lipids. In fact, the interaction between prosaposin and its derived saposins with sphingolipids has been extensively documented (22, 59, 61). Saposins C and D have also been shown to exhibit a high affinity for phospholipids. Furthermore, the presence of acidic phospholipids such as phosphatidylserine in membrane bilayers greatly favors their binding to saposin D (61). The interaction with phospholipids is a characteristic of several other saposin-like proteins (62), such as SP-B (63). Others members of the saposin-like protein family include the pore-forming peptide of Entamoeba hystolytica (64, 65), NK-lysin (66), acid sphingomyelinase (67), acyloxylacyl hydrolase (68), and plant aspartic proteinases (69, 70). Saposin-like proteins differ widely in function, but the activity of most of them is mediated via lipid interactions. Interestingly, the saposin-like domain within aspartic proteinase has been implicated in the vacuolar targeting of this protein by means of its interaction with membrane phospholipids (69).

Lysosomal prosaposin was initially found to be targeted to lysosomes in a mannose 6-phosphate-independent manner (40, 41, 43). When isolated Golgi fractions were permeabilized with a mild detergent (41), lysosomal prosaposin remained associated to the membrane, while secretory prosaposin (70 kDa) was released into the incubation medium. This suggests that the interaction of lysosomal prosaposin with phospholipid or sphingolipids may play a role in sorting and targeting this protein to the lysosomes. Recently, sphingomyelin, a membrane sphingolipid manufactured in the cis/medial region of the Golgi apparatus (71), was demonstrated to be involved in the transport of prosaposin to lysosomes (72). Cultured cells incubated with fumonisin B1, an inhibitor of sphingolipid synthesis that competes with sphinganine as a substrate of ceramide synthase (73), produced a dramatic decrease in the immunogold labeling of lysosomes with anti-prosaposin antibody. To examine if the mannose 6-phosphate receptor-mediated pathway was affected by this treatment, cells treated or not treated with fumonisin B1 were labeled with anti-cathepsin A antibody. The results showed no significant differences in the immunogold labeling of the lysosomal compartment of the treated and nontreated cells, indicating that the effect of fumonisin B1 on the transport of prosaposin to the lysosomes was specific. The effect of DL-threo-1-phenyl-2-decanoyl-amino-3-morpholino-1-propanol-HCL, a compound that selectively inhibits the synthesis of glycosphingolipids but not of sphingomyelin and/or ceramide, and the effect of tricyclodecan-9-yl xanthate potassium (D609), which specifically blocks the formation of sphingomyelin (74), were also examined. The results showed that only D609 blocked the transport of prosaposin to the lysosomes, suggesting that sphingomyelin was the main sphingolipid implicated in the association with prosaposin to the lysosomes (72).

During the course of this investigation we showed that the 65-kDa lysosomal prosaposin is Endo H-sensitive, whereas the 70-kDa secretory form is Endo H-resistant. Since the processing pathway within the Golgi apparatus is highly ordered, the treatment with this enzyme was used to distinguish complex from high mannose oligosaccharide linked to prosaposin (29, 75). Glycoproteins are modified in successive stages as they move through the Golgi-processing compartment. Thus, a significant fraction of the 65-kDa form must escape from the Golgi apparatus before it reaches the distal stacks, where it becomes fully glycosylated and Endo H-resistant. This notion was confirmed in cells transfected with the wild type prosaposin after incubation in BFA. BFA is a fungal antibacterial drug that causes rapid redistribution of proteins located in the Golgi apparatus but not of proteins residing in a post-Golgi compartment. Our results showed an intracellular retention of the 65-kDa protein, indicating that the lysosomal form only reaches the cis/medial region of the Golgi apparatus before sorting. The presence of negligible amounts of the 70-kDa protein in the medium represented secretory prosaposin that already passed the distal region of the Golgi prior to the addition of BFA.

Based on this evidence, a model, in which the interaction of prosaposin with phospholipids and/or sphingolipids may play an important role in bringing prosaposin close to the Golgi membrane near a "receptor protein," was proposed. According to this model, the C terminus of prosaposin may contain the binding site for this receptor protein, creating a receptor-ligand-like complex, which is then packed into cargo vesicles and transported to the endosomes, multivesicular bodies, and/or lysosomes. Interestingly, the C terminus of prosaposin is significantly similar (66%) to the N terminus of SP-B, which has been implicated in the targeting of this protein to the lamellar bodies in pneumocyte type II (47). Similar to prosaposin, which requires the C terminus and at least one saposin domain, SP-B also requires the presence of the N-terminal region and a yet unidentified sequence within the backbone of this protein that contains a saposin-like domain. Taken together, all of these results indicate that an alternative mechanism of sorting and transport of prosaposin between the Golgi apparatus and the lysosomes may exist. In conclusion, we demonstrated that the C terminus and at least one saposin domain may be sufficient for the lysosomal sorting and targeting of this sphingolipid activator protein.

    FOOTNOTES

* This work was supported by the Medical Research Council, Canada.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

Dagger Fellow of Fonds de la Recherche en Santé du Québec. To whom correspondence should be addressed: Dept. of Anatomy and Cell Biology, McGill University, 3640 University St., Montreal, Quebec H3A 2B2, Canada. Tel.: 514-398-6398; Fax: 514-398-5047; E-mail: cxco@musica.mcgill.ca.

Published, JBC Papers in Press, May 18, 2000, DOI 10.1074/jbc.M003497200

    ABBREVIATIONS

The abbreviations used are: BFA, brefeldin A; DMEM, Dulbecco's modified Eagle's medium; FITC, fluorescein isothiocyanate; PCR, polymerase chain reaction; kb, kilobase pair(s); PBS, phosphate-buffered saline; PAGE, polyacrylamide gel electrophoresis; Tricine, N-[2-hydroxy-1,1-bis(hydroxymethyl)ethyl]glycine; TBS, Tris-HCl-buffered saline; SP-B, surfactant protein B; ER, endoplasmic reticulum; Endo H, endoglycosidase H.

    REFERENCES
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

1. Morimoto, S., Martin, B. M., Yamamoto, Y., Kretz, K. A., O'Brien, J. S., and Kishimoto, Y. (1989) Proc. Natl. Acad. Sci. U. S. A. 86, 3389-3393
2. O'Brien, J. S., and Kishimoto, Y. (1991) FASEB J. 5, 301-308
3. Kishimoto, Y., Hiraiwa, M., and O'Brien, J. S. (1992) J. Lipid Res. 33, 1255-1267
4. Hakomori, S. (1981) Annu. Rev. Biochem. 50, 733-764
5. Hakomori, S. (1993) Biochem. Soc. Trans. 21, 583-595
6. Rademacher, T. W., Parekh, R. B., and Dwek, R. A. (1988) Annu. Rev. Biochem. 57, 785-838
7. Griffiths, G., Hoflack, B., Simons, K., Mellman, I., and Kornfeld, S. (1988) Cell 52, 329-341
8. Glew, R. H., Basu, A., LaMarco, K. L., and Prence, E. M. (1988) Lab. Invest. 58, 5-25
9. Wenger, D. A., Sattler, M., and Roth, S. (1982) Biochim. Biophys. Acta 712, 639-649
10. Inui, K., Emmett, M., and Wenger, D. A. (1983) Proc. Natl. Acad. Sci. U. S. A. 80, 3074-3077
11. Vogel, A., Furst, W., Abo-Hashish, M. A., Lee-Vaupel, M., Conzelmann, E., and Sandhoff, K. (1987) Arch. Biochem. Biophys. 259, 627-638
12. Morimoto, S., Martin, B. M., Kishimoto, Y., and O'Brien, J. S. (1988) Biochem. Biophys. Res. Commun. 156, 403-410
13. Klein, A., Henseler, M., Klein, C., Suzuki, K., Harzer, K., and Sandhoff, K. (1994) Biochem. Biophys. Res. Commun. 200, 1440-1448
14. Kretz, K. A., Carson, G. S., Morimoto, S., Kishimoto, Y., Fluharty, A. L., and O'Brien, J. S. (1990) Proc. Natl. Acad. Sci. U. S. A. 87, 2541-2544
15. Rafi, M. A., Zhang, X. L., DeGala, G., and Wenger, D. A. (1990) Biochem. Biophys. Res. Commun. 166, 1017-1023
16. Christomanou, H., Aignesberger, A., and Linke, R. P. (1986) Biol. Chem. Hoppe Seyler 367, 879-890
17. Bradova, V., Smid, F., Ulrich-Bott, B., Roggendorf, W., Paton, B. C., and Harzer, K. (1993) Hum. Genet. 92, 143-152
18. Fujita, N., Suzuki, K., Vanier, M. T., Popko, B., Maeda, N., Klein, A., Henseler, M., Sandhoff, K., and Nakayasu, H. (1996) Hum. Mol. Genet. 5, 711-725
19. Kondoh, K., Hineno, T., Sano, A., and Kakimoto, Y. (1991) Biochem. Biophys. Res. Commun. 181, 286-292
20. Sylvester, S. R., Skinner, M. K., and Griswold, M. D. (1984) Biol. Reprod. 31, 1087-1101
21. Hiraiwa, M., O'Brien, J. S., Kishimoto, Y., Galdzicka, M., Fluharty, A. L., Ginns, E. I., and Martin, B. M. (1993) Arch. Biochem. Biophys. 304, 110-116
22. Hiraiwa, M., Soeda, S., Kishimoto, Y., and O'Brien, J. S. (1992) Proc. Natl. Acad. Sci. U. S. A. 89, 11254-11258
23. Lamontagne, S., and Potier, M. (1994) J. Biol. Chem. 269, 20528-20532
24. O'Brien, J. S., Carson, G. S., Seo, H. C., Hiraiwa, M., Weiler, S., Tomich, J. M., Barranger, J. A., Kahn, M., Azuma, N., and Kishimoto, Y. (1995) FASEB J. 9, 681-685
25. Campana, W. M., Hiraiwa, M., and O'Brien, J. S. (1998) FASEB J. 12, 307-314
26. Campana, W. M., Darin, S. J., and O'Brien, J. S. (1999) J. Neurosci. Res. 57, 332-341
27. Igdoura, S. A., and Morales, C. R. (1995) Mol. Reprod. Dev. 40, 91-102
28. Rosenthal, A. L., Igdoura, S. A., Morales, C. R., and Hermo, L. (1995) Mol. Reprod. Dev. 40, 69-83
29. von Figura, K., and Hasilik, A. (1986) Annu. Rev. Biochem. 55, 167-193
30. Braun, M., Waheed, A., and von Figura, K. (1989) EMBO J. 8, 3633-3640
31. Fambrough, D. M., Takeyasu, K., Lippincott-Schwartz, J., and Siegel, N. R. (1988) J. Cell Biol. 106, 61-67
32. Mathews, P. M., Martinie, J. B., and Fambrough, D. M. (1992) J. Cell Biol. 118, 1027-1040
33. Maillet, C. M., and Shur, B. D. (1993) Exp. Cell Res. 208, 282-295
34. Rohrer, J., Schweizer, A., Russell, D., and Kornfeld, S. (1996) J. Cell Biol. 132, 565-576
35. Williams, M. A., and Fukuda, M. (1990) J. Cell Biol. 111, 955-966
36. Harter, C., and Mellman, I. (1992) J. Cell Biol. 117, 311-325
37. Guarnieri, F. G., Arterburn, L. M., Penno, M. B., Cha, Y., and August, J. T. (1993) J. Biol. Chem. 268, 1941-1946
38. Honing, S., Griffith, J., Geuze, H. J., and Hunziker, W. (1996) EMBO J. 15, 5230-5239
39. Sandoval, I. V., Arredondo, J. J., Alcalde, J., Gonzalez Noriega, A., Vandekerckhove, J., Jimenez, M. A., and Rico, M. (1994) J. Biol. Chem. 269, 6622-6631
40. Rijnboutt, S., Kal, A. J., Geuze, H. J., Aerts, H., and Strous, G. J. (1991) J. Biol. Chem. 266, 23586-23592
41. Igdoura, S. A., Rasky, A., and Morales, C. R. (1996) Cell Tissue Res. 283, 385-394
42. Zhu, Y., and Conner, G. E. (1994) J. Biol. Chem. 269, 3846-3851
43. Vielhaber, G., Hurwitz, R., and Sandhoff, K. (1996) J. Biol. Chem. 271, 32438-32446
44. Morimoto, S., Yamamoto, Y., O'Brien, J. S., and Kishimoto, Y. (1990) Anal. Biochem. 190, 154-157
45. Azuma, N., Seo, H. C., Lie, O., Fu, Q., Gould, R. M., Hiraiwa, M., Burt, D. W., Paton, I. R., Morrice, D. R., O'Brien, J. S., and Kishimoto, Y. (1998) Biochem. J. 330, 321-327
46. Zhao, Q., Bell, A. W., El-Alfy, M., and Morales, C. R. (1998) J. Androl. 19, 165-174
47. Lin, S., Akinbi, H. T., Breslin, J. S., and Weaver, T. E. (1996) J. Biol. Chem. 271, 19689-19695
48. Hook, G. E., and Gilmore, L. B. (1982) J. Biol. Chem. 257, 9211-9220
49. Voorhout, W. F., Veenendaal, T., Haagsman, H. P., Weaver, T. E., Whitsett, J. A., van Golde, L. M., and Geuze, H. J. (1992) Am. J. Physiol. 263, L479-L486
50. Misumi, Y., Miki, K., Takatsuki, A., Tamura, G., and Ikehara, Y. (1986) J. Biol. Chem. 261, 11398-11403
51. Lippincott-Schwartz, J., Yuan, L. C., Bonifacino, J. S., and Klausner, R. D. (1989) Cell 56, 801-813
52. Collard, M. W., Sylvester, S. R., Tsuruta, J. K., and Griswold, M. D. (1988) Biochemistry 27, 4557-4564
53. O'Brien, J. S., Kretz, K. A., Dewji, N., Wenger, D. A., Esch, F., and Fluharty, A. L. (1988) Science 241, 1098-1101
54. Sylvester, S. R., Morales, C., Oko, R., and Griswold, M. D. (1989) Biol. Reprod. 41, 941-948
55. Igdoura, S. A., Hermo, L., Rosenthal, A., and Morales, C. R. (1993) Anat. Rec. 235, 411-424
56. Kolter, T., and Sandhoff, K. (1998) Brain Pathol. 8, 79-100
57. Sandhoff, K., and Kolter, T. (1997) Clin. Chim. Acta 266, 51-61
58. Kornfeld, S., and Sly, W. S. (1985) Hosp. Pract. 20, 71-75, 78-82
59. Azuma, N., O'Brien, J. S., Moser, H. W., and Kishimoto, Y. (1994) Arch. Biochem. Biophys. 311, 354-357
60. Potier, M., Lamontagne, S., Michaud, L., and Tranchemontagne, J. (1990) Biochem. Biophys. Res. Commun. 173, 449-456
61. Vaccaro, A. M., Salvioli, R., Tatti, M., and Ciaffoni, F. (1999) Neurochem. Res. 24, 307-314
62. Munford, R. S., Sheppard, P. O., and O'Hara, P. J. (1995) J. Lipid Res. 36, 1653-1663
63. Johansson, J., Curstedt, T., and Jornvall, H. (1991) Biochemistry 30, 6917-6921
64. Leippe, M., Tannich, E., Nickel, R., van der Goot, G., Pattus, F., Horstmann, R. D., and Muller-Eberhard, H. J. (1992) EMBO J. 11, 3501-3506
65. Lynch, E. C., Rosenberg, I. M., and Gitler, C. (1982) EMBO J. 1, 801-804
66. Andersson, M., Gunne, H., Agerberth, B., Boman, A., Bergman, T., Sillard, R., Jornvall, H., Mutt, V., Olsson, B., Wigzell, H., Dagerlind, A., Boman, H. G., and Gudmundsson, G. H. (1995) EMBO J. 14, 1615-1625
67. Ponting, C. P. (1994) Protein Sci. 3, 359-361
68. Hagen, F. S., Grant, F. J., Kuijper, J. L., Slaughter, C. A., Moomaw, C. R., Orth, K., O'Hara, P. J., and Munford, R. S. (1991) Biochemistry 30, 8415-8423
69. Guruprasad, K., Tormakangas, K., Kervinen, J., and Blundell, T. L. (1994) FEBS Lett. 352, 131-136
70. Ponting, C. P., and Russell, R. B. (1995) Trends Biochem. Sci. 20, 179-180
71. Futerman, A. H., Stieger, B., Hubbard, A. L., and Pagano, R. E. (1990) J. Biol. Chem. 265, 8650-8657
72. Lefrancois, S., Michaud, L., Potier, M., Igdoura, S., and Morales, C. R. (1999) J. Lipid Res. 40, 1593-1603
73. Mays, R. W., Siemers, K. A., Fritz, B. A., Lowe, A. W., van Meer, G., and Nelson, W. J. (1995) J. Cell Biol. 130, 1105-1115
74. Luberto, C., and Hannun, Y. A. (1998) J. Biol. Chem. 273, 14550-14559
75. Kornfeld, S., and Mellman, I. (1989) Annu. Rev. Cell Biol. 5, 483-525
76. Molkentin, J. D., Black, B. L., Martin, J. F., and Olson, E. N. (1995) Cell 83, 1125-1136


Copyright © 2000 by The American Society for Biochemistry and Molecular Biology, Inc.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
Hum Mol GenetHome page
V. Seyrantepe, M. Canuel, S. Carpentier, K. Landry, S. Durand, F. Liang, J. Zeng, A. Caqueret, R. A. Gravel, S. Marchesini, et al.
Mice deficient in Neu4 sialidase exhibit abnormal ganglioside catabolism and lysosomal storage
Hum. Mol. Genet., June 1, 2008; 17(11): 1556 - 1568.
[Abstract] [Full Text] [PDF]


Home page
Hum Mol GenetHome page
Y. Sun, D. P. Witte, M. Zamzow, H. Ran, B. Quinn, J. Matsuda, and G. A. Grabowski
Combined saposin C and D deficiencies in mice lead to a neuronopathic phenotype, glucosylceramide and {alpha}-hydroxy ceramide accumulation, and altered prosaposin trafficking
Hum. Mol. Genet., April 15, 2007; 16(8): 957 - 971.
[Abstract] [Full Text] [PDF]


Home page
MicrobiologyHome page
X. Madriz, M. B. Martinez, M. A. Rodriguez, G. Sierra, C. Martinez-Lopez, A. M. Riveron, L. Flores, and E. Orozco
Expression in fibroblasts and in live animals of Entamoeba histolytica polypeptides EhCP112 and EhADH112
Microbiology, May 1, 2004; 150(5): 1251 - 1260.
[Abstract] [Full Text] [PDF]


Home page
ScienceHome page
D. Zhou, C. Cantu III, Y. Sagiv, N. Schrantz, A. B. Kulkarni, X. Qi, D. J. Mahuran, C. R. Morales, G. A. Grabowski, K. Benlagha, et al.
Editing of CD1d-Bound Lipid Antigens by Endosomal Lipid Transfer Proteins
Science, January 23, 2004; 303(5657): 523 - 527.
[Abstract] [Full Text] [PDF]


Home page
J. Biol. Chem.Home page
S. Lefrancois, T. May, C. Knight, D. Bourbeau, and C. R. Morales
The Lysosomal Transport of Prosaposin Requires the Conditional Interaction of Its Highly Conserved D Domain with Sphingomyelin
J. Biol. Chem., May 3, 2002; 277(19): 17188 - 17199.
[Abstract] [Full Text] [PDF]


Home page
Proc. Natl. Acad. Sci. USAHome page
J. Piatigorsky, B. Norman, L. J. Dishaw, L. Kos, J. Horwitz, P. J. Steinbach, and Z. Kozmik
J3-crystallin of the jellyfish lens: Similarity to saposins
PNAS, October 23, 2001; 98(22): 12362 - 12367.
[Abstract] [Full Text] [PDF]


Home page
Hum Mol GenetHome page
H. Hulkova, M. Cervenkova, J. Ledvinova, M. Tochackova, M. Hrebicek, H. Poupetova, A. Befekadu, L. Berna, B.C. Paton, K. Harzer, et al.
A novel mutation in the coding region of the prosaposin gene leads to a complete deficiency of prosaposin and saposins, and is associated with a complex sphingolipidosis dominated by lactosylceramide accumulation
Hum. Mol. Genet., April 1, 2001; 10(9): 927 - 940.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
275/32/24829    most recent
M003497200v1
Right arrow Submit a Letter to Editor
Right arrow Alert me when this article is cited
Right arrow Alert me when eLetters are posted
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowRequest Permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Zhao, Q.
Right arrow Articles by Morales, C. R.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Zhao, Q.
Right arrow Articles by Morales, C. R.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?


HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 All ASBMB Journals   Molecular and Cellular Proteomics 
 Journal of Lipid Research   ASBMB Today 
Copyright © 2000 by the American Society for Biochemistry and Molecular Biology.
Advertisement
spacer
Advertisement
Advertisement