|
Originally published In Press as doi:10.1074/jbc.M104656200 on June 25, 2001
J. Biol. Chem., Vol. 276, Issue 39, 36586-36597, September 28, 2001
Amelogenin-Cytokeratin 14 Interaction in
Ameloblasts during Enamel Formation*
Rajeswari M. H.
Ravindranath ,
Wai-Yin
Tam,
Pablo
Bringas Jr.,
Valentino
Santos, and
Alan G.
Fincham
From the Center for Craniofacial Molecular Biology, School of
Dentistry, University of Southern California,
Los Angeles, California 90033
Received for publication, May 22, 2001, and in revised form, June 18, 2001
 |
ABSTRACT |
The enamel protein amelogenin binds
to the GlcNAc-mimicking peptide (GMp) (Ravindranath, R. M. H., Tam, W., Nguyen, P., and Fincham, A. G. (2000) J. Biol. Chem. 275, 39654-39661). The GMp motif is found in the
N-terminal region of CK14, a differentiation marker for ameloblasts.
The binding affinity of CK14 and amelogenin was confirmed by dosimetric
binding of CK14 to recombinant amelogenin (rM179), and to the
tyrosine-rich amelogenin polypeptide. The specific binding site
for CK14 was identified in the amelogenin trityrosyl motif peptide
(ATMP) of tyrosine-rich amelogenin polypeptide and specific interaction
between CK14 and [3H]ATMP was confirmed by Scatchard
analysis. Blocking rM179 with GlcNAc, GMp, or CK14 with ATMP abrogates
the CK14-amelogenin interaction. CK14 failed to bind to ATMP when the
third proline was substituted with threonine, as in some cases of human
X-linked amelogenesis imperfecta or when tyrosyl residues were
substituted with phenylalanine. Morphometry of developing teeth
distinguished three phases of enamel formation; growth initiation phase
(days 0-1), prolific growth phase (days 1-7), and growth cessation
phase (post-day 7). Confocal microscopy revealed co-assembly of
CK14/amelogenin in the perinuclear region of ameloblasts on day 0, migration of the co-assembled CK14/amelogenin to the apical region of
the ameloblasts from day 1, reaching a peak on days 3-5, and a
collapse of the co-assembly. Autoradiography with
[3H]ATMP and [3H]GMp corroborated the
dissociation of the co-assembly at the ameloblast Tomes' process. It
is proposed that CK14 play a chaperon role for nascent amelogenin
polypeptide during amelogenesis.
 |
INTRODUCTION |
Dental enamel is formed within a protein matrix secreted by
ameloblast cells of ectodermal origin (1). Ameloblasts synthesize several matrix proteins (2) and also cytokeratins 5 and 14 (3-5).
Ninety percent of the enamel matrix protein constitutes amelogenins
(6-8). Amelogenins are tissue-specific, non-glycosylated proteins,
rich in proline, glutamine, leucine, and histidine. Post-secretory
processing of amelogenins involves a series of discrete steps including
supramolecular self-assembly and progressive proteolytic reduction in
molecular size, facilitating enamel biomineralization and maturation
(9). Little is known about the presecretory and secretory stages of
amelogenesis. Understanding of these events may shed light on the
significance of the interaction of amelogenins with other ameloblast
proteins, and the functional roles of the different domains of
amelogenin polypeptide structures, including the possible significance
of the highly conserved phosphorylation locus at serine 16, which
remains enigmatic.
While seeking to define the functional role of different domains of
amelogenins, we have observed that the conserved tri-tyrosyl motif
(amelogenin tri-tyrosyl motif peptide
(ATMP):1 PYPSYGYEPMGGW) of
the N-terminal region of amelogenins binds specifically to
N-acetylglucosamine (GlcNAc) of glycoconjugates (10).
Furthermore, we have demonstrated that the ATMP also recognizes peptide
mimics of GlcNAc (11). Most importantly, one of the GlcNAc mimicking
peptides (GMp: SFGSGFGGGY) binds avidly to ATMP. Modifications of the
ATMP motif, including substitution of proline 3 by threonine as
observed in a case of human X-linked amelogenesis imperfecta
(12), resulted in the loss of binding to both GlcNAc and GMp (10, 11).
Interestingly, the GMp sequence is localized in the highly conserved
N-terminal domain of cytokeratins 14, 16, and 17. Since CK14 is a
known marker for ameloblasts in a developing tooth prior to synthesis
of amelogenins (3-5) and it contains the GMp that binds specifically
to the ATMP sequence of amelogenins, we hypothesize that interactions
between CK14 and amelogenins may play an important role in
amelogenesis, enamel development, and disease.
In the present investigation, we demonstrate that CK14 binds
specifically to amelogenins through the ATMP. Furthermore, we show that putative loss of function mutations of ATMP (e.g.
substitution of a proline residue with threonine, as noted above)
abrogates binding of amelogenins to CK14. Using confocal laser
microscopy, we demonstrate co-assembly of amelogenin-CK14, its
migration to the apical region of ameloblasts, and subsequent
dissociation at Tomes' process. Our findings suggest that CK14
functions as a chaperon for nascent amelogenin polypeptides during amelogenesis.
 |
EXPERIMENTAL PROCEDURES |
Animals--
Twenty-five normal, healthy, female Swiss Webster
pregnant mice (Charles River Breeding) were used to obtain a sufficient number of litters for this study. All protocols involving mice were
approved by the Institutional Animal Care and Use Committee (Los
Angeles, CA). Mandibles were obtained from Swiss Webster mice at
different developmental stages ranging from E18-day pregnant mice
through newborn (NB) day "0," postnatal days (PN) 1, 3, 5, 7, and
9. Mandibular incisors were used for morphometric studies.
Amelogenin Proteins--
The recombinant mouse amelogenin rM179
(20.16 kDa) was prepared by expression in Escherichia coli,
isolated, and purified by high performance liquid chromatography as
previously described (13). The protein was further purified by
analytical reversed phase HPLC and homogeneity was assessed by SDS-PAGE
(10, 11). The amino acid sequence of this protein (ATMP in bold) is as
follows: rM179,
PLPPHPGSPGYINLSYEVLTPLKWYQSMIRQPYPSYGYEPMGGW- LHHQIIPVLSQQHPPSHTLQPHHHLPVVPAQQPVAPQQPMMPVP- GHHSMTPTQHHQPNIPPSAQQPFQQPFQPQAIPPQSHQPMQP- QSPLHPMQPLAPQPPLPPLFSMQPLSPILPELPLEAWPATDKTKR- EEVD179..
The polypeptides used in this investigation include: TRAP (5.20 kDa), a
synthetic polypeptide representing the N-terminal conserved 45 amino
acid residues of amelogenins; LRAP (6.82 kDa), a synthetic leucine-rich
amelogenin polypeptide (a polypeptide sharing 33 amino acid residues of
the N terminus and 26 amino acid residues of the C terminus of
full-length amelogenins); ATMP (1.45 kDa) (see sequence above), a
synthetic polypeptide, representing the 13 C-terminal residues of the
TRAP amelogenin and the two altered ATMP peptides; T-ATMP
(PYPSYGYETMGGW) and F-ATMP (PFPSFGFEPMGGW). P162
(23 kDa) and P148 (20 kDa) (Porcine amelogenins) were isolated from
unerupted mandibular pig molars and purified as previously described
(10).
Synthesis and Purification of Polypeptides--
All the
polypeptides used (TRAP, LRAP, ATMP, T-ATMP, F-ATMP, and GMp
(SFGSGFGGGY located at the highly conserved N-terminal region of CK14)
in this study were synthesized by the University of Southern California
Microchemical Core Laboratory using an Applied Biosystems model 430A
single column peptide synthesizer with the modified Merrifield
procedure (14). Peptides were purified by reversed phase HPLC
(C4-214TP54 column or C18-291HS54 column (Vydac, The Separations
Group, Hesperia, CA) with a gradient of 35-50% B in 60 min (B
contained 60% (v/v) aqueous acetonitrile in 0.1% (v/v)
trifluoroacetic acid) at a flow rate of 1.0 ml/min (10, 11).
Specificity of the Antibodies--
The murine monoclonal
antibody for CK14 (clone LL002) is affinity purified and specifically
recognizes the 14 C-terminal residues of CK14 (15). Anti-amelogenin
antibody is developed in rabbits after immunizing with recombinant
amelogenin rM179 (13). The specificity of the antibody was assessed
using different fragments of amelogenin in ELISA (16-18). The
polyclonal antibody (at 1/6000) binds better to rM166 (a construct that
lacks the hydrophilic C-terminal 13-residue segment), than to rM179 at
the same concentration (50 ng/well), suggesting that the C-terminal
acidic residues are not essential for binding. The antibody did not
recognize the N-terminal TRAP region in ELISA or in Western blots
suggesting that it recognizes the hydrophobic central core of the amelogenin.
3H Labeling of ATMP and GMp--
The 13-residue ATMP
(P[3H]YPSYGYEPMGGW) was prepared from tritium gas by
Nycomed Amersham Plc. (Amersham Pharmacia Biotech) and after labeling,
the material co-chromatographed with the ATMP synthesized by the
University of Southern California Microchemical Core Laboratory. A mass
spectrum is consistent with the proposed structure. The material was
supplied as a water:ethanol (1:1, v/v) solution in a silanized
borosilicate multidose vial with additional screw cap under nitrogen.
GMp (SFGSGFGGG[3H]Y) was also labeled as noted previously
(11). Polypeptides were purified by HPLC on a Vydac C18 300-Å (protein
or peptide: 250 × 4.6 mm) column with a gradient of solution A
(0.01 M aqueous trifluoroacetic acid) and solution B (0.01 M trifluoroacetic acid in acetonitrile), 0-100% B over 30 min, at a flow rate of 1.0 ml/min. The peptide was supplied in an
aqueous solution. The peptides were stored in the absence of light and
air at 20 or 4 °C, respectively.
Binding of rM179 and TRAP to CK14 by Enzyme-linked Immunosorbent
Assay (ELISA)--
ELISA was performed using CK14 (RDI Research
Diagnostics, Inc.) or TRAP as antigen following the protocol previously
described (16-18). Antigen coating was done by adding 100 µl of a
solution containing varying amounts of CK14 (Research Diagnostics) in
PBS (pH 7.2), TRAP in carbonate and bicarbonate buffer (pH 9.6) was added to wells (Falcon 3915, Fisher Scientific, Pitsburgh, PA) and
incubated at room temperature overnight. Wells were blocked with PBS
containing 1% HSA at 37 °C for 1 h. One-hundred microliters of
a known amount of rM179 (5 pmol/100 µl)/CK14 (10 pmol/100 µl) was
added to wells and incubated for 1 h at 37 °C. After washing the plates five times, primary antibody against the recombinant M179
protein (12) (at a dilution of 1:6000) or anti-CK14 affinity purified
murine monoclonal (1:1000) (LL002 Neomarkers) (15) was added and
incubated for 1 h at 37 °C and then incubated with the
secondary antibody (goat anti-rabbit IgG; Jackson ImmunoResearch, West
Grove, PA, rabbit anti-mouse IgG) for 1 h. After washing, substrate (o-phenylenediamine dihydrochloride; Life
Technologies, Inc., Gaithersburg, MD) in citrate-phosphate buffer and
hydrogen peroxidase) was added to the plates for color development. The enzymatic oxidation was arrested after 30 min in the dark, with 6 N H2SO4. The absorbence difference
at 490-650 nm was measured after automix in a Bio-Tek microplate
reader (Bio-Tek Instruments). The values were corrected for background
(wells without antigen). BSA and LRAP were used as negative controls.
Assessment of Binding of CK14 with Amelogenins by Western Blot
Analysis--
The proteins were resolved via SDS-PAGE using 12 or 15%
resolving and 3.5% stacking gels (19) and electrotransfered to
polyvinylidene difluoride (PVDF) membranes (Millipore Corp.,
Immunolon-P Transfer Membrane) at 100 mA for 1 h using a semidry
transblot apparatus (Hoefer Scientific Instruments, San Francisco, CA)
(11, 20). Protein transfer was assessed by staining the PVDF strips
with 0.1% Fast Green (Sigma) in 40% methanol and 10% acetic acid,
and the strips were compared with Coomassie Blue-stained protein bands (11, 21). Replicas were treated with ligands (GlcNAc, GMp) after
blocking the membrane with phosphate-buffered saline, 1% HSA for
1 h at 37 °C. The membranes were washed five times with phosphate-buffered saline containing 0.1% HSA (11, 22). After washing,
the membranes were overlaid with CK14 alone or CK14 preincubated with
ATMP for 1 h. The strips were washed (5 times) and immunostained with anti-CK14 monoclonal antibody for CK14 (clone LL002, 1/1000).
Dosimetric Binding of CK14 to [3H]ATMP--
100
µl of [3H]ATMP (30 × 104 dpm in
Tris-buffered saline, pH 7.2) was added to 1.5-ml polypropylene
microcentrifuge tubes containing increasing amounts of CK14 in
Tris-buffered saline (pH 7.2) and the mixture was gently shaken every
20 min for 2 h at 37 °C. The proteins were precipitated with 1 ml of cold ethanol (200 proof; Gold Shield Chemical Co., Hayward, CA)
at 4 °C for 20 min, centrifuged for 15 min at 12,000 × g, and the supernatant was removed. The unbound
[3H]ATMP was removed completely by repeated vortex mixing
and washing four times with ethanol. The final pellets were dissolved
in 50 µl of 1 N NaOH, and bound radioactivity was
measured 15 min after adding 4 ml of scintillation fluid (Amersham
Pharmacia Biotech) in a -counter, as described elsewhere (10,
11).
Specific Binding of CK14 to [3H]ATMP as a Function
of Increasing Concentration of ATMP--
The total binding of labeled
ATMP to CK14 (350 pmol) was determined using increasing concentrations
of [3H]ATMP (2-600 pmol). The nonspecific binding of
labeled ATMP was determined in the presence of 40 nmol of unlabeled
ATMP at 37 °C for 2 h and was subtracted from the total binding
to obtain the specific binding. The specific binding was further
analyzed by the Scatchard plot.
Loss of Function "Mutations" of ATMP Results in Loss of
Binding to CK14 as Assessed by Western Blot Analysis--
Recombinant
M179 on SDS-PAGE were electrotransfered to PVDF membranes at 100 mA for
1 h using a semidry transblot apparatus. Protein transfer was
assessed as described in the legend to Fig. 3. After blocking the
membrane with 1% HSA in PBS for 1 h at 37 °C and washing, the
membranes were overlaid with CK14 alone or CK14 preincubated (for
1 h) with ATMP or CK14 preincubated with T-ATMP or F-ATMP. The
strips were immunostained with murine monoclonal antibody for CK14
(clone LL002, 1/1000).
Morphological Analyses--
Mouse mandibular molar tissues for
immunohistochemistry were fixed immediately in 10% neutral buffered
formalin for 12 h at 4 °C. The fixed tissues were embedded in
paraffin and 6-µm saggital sections were mounted on Histostik-coated
slides (Accurate Chemical and Scientific Corp., Westbury, NY). Tissues
for enamel morphometric studies were fixed in formalin for 24 h,
decalcified with 10% EDTA. Day "0" mandibles were decalcified for
2 h (PN), day 1 for 4 h, day 3 for 30 h, day 5 for
66 h, day 7 for 108 h, and day 9 samples for 156 h,
washed, and then processed for paraffin embedding.
Morphometry of Enamel during Tooth Development--
The serial
cross-sections (6 µM) obtained from the whole length of
the mouse mandibular incisor (PN 0, 1, 3, 5, 7, and 9) was taken as
100%. The sections were stained with Mallory's triple stain for 5 min
and the width of enamel was measured at the 40 and 60% level from the
base of the incisor using the software program Image-Pro Plus 4.0 (Media Cybernetics, L. P.) on 9 sections (three incisors from
three mice) per day.
Immunochemical Localization of CK14 in Ameloblasts--
Saggital
sections (6-µm) of mouse mandibular molar of day 0 (NB), day 1, 3, 5, 7, and 9 (PN) were deparaffinized and immunostained. Endogenous
peroxidase activity was blocked with 3% H2O2.
Tissue sections were treated with 1% HSA in PBS (pH 6.0) and then
incubated with affinity purified mouse monoclonal antibody for CK14
(LL002, 1/500) at 37 °C for 1 h. Negative controls were
performed by replacing the primary antibody with Tris-buffered saline
and also IgG isotypes. Biotinylated anti-mouse secondary antibody was
added to sections, incubated for 30 min at room temperature, and rinsed
(3 times). The sections were treated with streptavidin-peroxidase
conjugate for 30 min at room temperature and stained with
hematoxylin:eosin. The images were photographed.
Co-localization of CK14 and Amelogenins with Confocal Laser
Scanning Microscopy in Ameloblasts during Enamel Formation--
To
examine the spatial distribution and co-localization of CK14 and
amelogenin, saggital sections of mouse postnatal mandibular molars at
different developmental stages were prepared as described earlier (23,
24). The sections were deparaffinized, rehydrated, and endogenous
peroxidase activity was blocked with 3% H2O2.
The sections were stained with primary antibody against CK14 and then incubated with fluorescein isothiocyanate (FITC)-conjugated secondary antibody (goat anti-mouse IgG, Jackson Immuno Research, West Grove, PA), 1:40 dilution, for 30 min at room temperature. The sections were
sequentially stained with the primary antibody against recombinant mouse amelogenin for 1 h and then incubated with the secondary antibody coupled with tetramethylrhodamin isothiocyanate (TRITC) to
goat anti-rabbit IgG (Jackson ImmunoResearch, West Grove, pA), 1:40
dilution for 30 min at room temperature. Replacing the primary antibody
with Tris-buffered saline and also IgG isotypes performed as negative
controls. Sections were then washed, mounted immediately with glycerol
(95% glycerol with 5% phosphate buffer as mounting media), and
examined with a Zeiss Laser Scan Microscope (LSM 510) (Carl Zeiss,
Oberkochen, Germany) equipped with a 514 argon and a 543
helium-neon laser.
To determine coassembly of CK14 and amelogenin in vivo,
co-localization was studied on sections stained sequentially with FITC-conjugated antibody for CK14 (green signal at 514) and
TRITC-conjugated antibody for amelogenin (red signal at 543) (25-28).
The 514- and 543-nm lines of an argon-helium-neon laser exited FITC and
TRITC, respectively. Both lines pass through a dichroic mirror and a neutral density filter before passing through the cell. The emitted light reflected from the sample and fluorescence was collected by an
oil immersion lens and imaged on to a photomultiplier tube after
passing through a confocal aperture at an optical filter. The cells
were scanned at 4 s/frame and averaged twice to reduce background
noise. The laser power was adjusted to ensure any photodynamic effect
on the cells was negligible.
Lectin Histochemistry--
Sections from mouse mandibular tooth
organs (PN day 5) were treated with lectins before and after treatment
with sialidase. The following lectins were used; Triticum
vulgaris (wheat germ agglutinin) that binds to sialic acid and
GlcNAc (29, 30) and Datura stramomium specific for GlcNAc
(purchased from EY Laboratories) (31). Sections were treated with
neuraminidase to rule out the staining due to sialic acids.
Clostridium perfringens neuraminidase (type X) (purchased
from Sigma) was used in all the major experiments. The enzyme
treatments were done as described elsewhere (10, 22). Briefly, the
sections were overlaid with 200 milliunits of enzyme in 200 µl of
PBS/section and were incubated for 1 h at 37 °C. After washing,
the sections were treated with lectin peroxidase-coupled wheat germ
agglutinin or biotinylated D. stramomium (1 mg/ml,
1:10).
Autoradiography of [3H]ATMP to CK14 and
3H-Labeled GMp to Amelogenins--
Sections from mouse
mandibular tooth organs (saggital sections, 6 µm) were used to assess
the localization of free CK14 or free amelogenins in ameloblasts during
enamel formation. Sections were treated with 50 milliunits of
N-acetylglucosaminidase (Sigma) (22) to assess the location
of free CK14 in ameloblasts. The sections were blocked with PBS (pH
6.0) with 1.0% HSA at 37 °C for 1 h and then incubated with
[3H]ATMP or 3H-labeled GMp for 2 h at
37 °C to identify free CK14 or amelogenins. After washing the slides
3 times with PBS (0.1% HSA, pH 6.0), the slides were dried for 30 min
at room temperature. Each slide was dipped separately in emulsion fluid
diluted in water at 1:1 dilution (Kodak Autoradiography Emulsions, Type
NTB2 for emitters, International Biotech Inc. Eastman Kodak Co.,
New Haven, CT) in the dark for 1 min, dried, and stored at 4 °C. The
autoradiographs were developed in Kodak DEKTOL Developer (Eastman Kodak
Co., Rochester, NY) according to the manufacturers recommendations and
counterstained with hematoxylin. Digital and phase contrast microscopy
was used to identify the grains on sections.
Quantitative Analysis of Images using LSM 510--
The scatter
diagram (co-localization) is created and analyzed for pixel
distribution (27). All pixels having the same positions in both images
are considered a pair. Of every pair of pixels (P1, P2) from the two
images, the brightness level of pixel P1 is interpreted as the
X coordinate, and that of pixel P2 as the Y
coordinate of the scatter diagram. Non-co-localized P1 and P2 pixels
and the background values were excluded to distinguish the pixels that
are co-localized. The results were expressed as percentage of
co-localization of amelogenins and CK14 at different developmental
stages from day 0 to 9 from initiation, growth, and cessation
(double-headed arrow) of enamel formation. The
quantity of non-co-localized P1 and P2 pixels representing free
amelogenin and free CK14, respectively, are also plotted for comparison.
 |
RESULTS |
Recombinant amelogenin (rM179) is a 20.16-kDa polypeptide with 179 amino acids. It differs from native amelogenin only in the absence of
the N-terminal methionine and that serine at position 16 is not
phosphorylated. The ATMP sequence that interacts with CK14 is localized
in the C-terminal region of TRAP. It binds to GlcNAc as well as the GMp
localized in the N-terminal head region of CK14. The specific binding
of ATMP-GMp was confirmed earlier (11).
rM179 and TRAP Interact with CK14--
Solid matrix immunoassay
analysis of the interaction between CK14 and amelogenins showed
dosimetric binding of recombinant M179 to CK14 (Fig.
1A). Low (<0.15) but no
dose-dependent binding was observed with BSA. Fig.
1B indicates a similar dose-dependent binding of
CK14 to TRAP. The titration does not reach saturation unlike in Fig.
1A. No binding was observed with LRAP.

View larger version (13K):
[in this window]
[in a new window]
|
Fig. 1.
A, amelogenin (rM179) binding to varying
concentrations of CK14 as measured by a solid matrix immunoassay.
B, cytokeratin-14 (CK14) binding to varying
concentrations of TRAP by a solid matrix immunoassay.
|
|
CK14- and Amelogenin Interaction on Western Blot--
The results
(Fig. 2) show that CK14 binds to rM179
(lane 5) native porcine amelogenins (lanes 9 and
10) P148 and P162 and TRAP (lane 12). The binding
of CK14 to amelogenin was abrogated when the Western blot of rM179 was
pretreated (overlaid and washed) with GlcNAc or GMp (lanes 6 and 7 and Table I). Similarly
when CK14 was preincubated with ATMP it failed to bind to rM179
(lane 8 and Table I), suggesting that the CK14-rM179
interaction involves ATMP binding with the GMp motif of CK14.

View larger version (36K):
[in this window]
[in a new window]
|
Fig. 2.
Western blot analysis of binding of CK14 with
rM179 and TRAP in the presence and absence of inhibitors.
Recombinant M179, TRAP, and BSA (negative control) on SDS-PAGE were
electrotransfered to PVDF membranes at 100 mA for 1 h using a
semidry transblot apparatus. Lanes 1-10, transblot from
12% gel. Lane 1, standards; Lane 2, CK14 plus
anti-CK and 2nd antibody; Lane 3, CK14 plus
2nd antibody only; Lane 4, immunostaining rM179
without CK14 with anti-CK14 antibody and second antibody, no staining
observed; Lane 5, immunostaining of CK14 bound to rM179;
Lane 6, immunostaining of CK14 added to rM179 after overlay
with GlcNAc, no staining observed; Lane 7, immunostaining of
CK14 added to rM179 after overlay with GMp, no staining observed;
Lane 8, immunostaining of CK14 after rM179 overlaid with
CK14 preincubated with ATMP, no staining observed; Lane 9, immunostaining of CK14 on native (porcine) amelogenin P148; Lane
10, immunostaining of CK14 on native (porcine) P162; Lanes
11-13, transblot from 15% gel; Lane 11, standards;
Lane 12, immunostaining of CK14 bound to TRAP; Lane
13, immunostaining of CK14 on BSA (negative control), no staining
observed.
|
|
View this table:
[in this window]
[in a new window]
|
Table I
Amelogenin-CK14 interaction in Western Blots in the presence and
absence of specific inhibitors
Recombinant M179 on SDS-PAGE were electrotransfered to PVDF membranes
at 100 mA for 1 h using a semidry transblot apparatus. After
assessment of protein transfer, the replicas were treated with GlcNAc
or GMp1, after blocking the membrane with 1% HSA in PBS for 1 h
at 37 °C. After washing, the membranes were overlaid with CK14 alone
or CK14 preincubated (for 1 h) with ATMP or T-ATMP or F-ATMP. The
strips were immunostained with affinity purified, murine monoclonal
antibody for CK14 (clone LL002, L1000).
|
|
Specific Binding of [3H]ATMP to CK14--
To select
the optimal concentration of CK14 for assessing the specific
interaction between CK14 and ATMP, the dosimetry of [3H]ATMP binding to CK14 was determined (Fig.
3A). The purity and homogeneity of ATMP was assessed by reversed phase HPLC and a typical
profile of the purified fraction is illustrated in the inset
of Fig. 3A. Fig. 3B shows the specific binding of
[3H]ATMP to CK14 as a function of increasing
concentration of ATMP. The nonspecific binding was measured with
unlabeled ATMP and subtracted from the total binding to obtain the
specific ATMP-CK14 interaction. A Scatchard plot of the binding of
[3H]ATMP to CK14 indicates that the peptide-binding site
is homogenous with respect to the association constant. The
significance of the slope (p < 0.001) and
r2 (0.96) are indicated in the Fig.
3B, inset.

View larger version (20K):
[in this window]
[in a new window]
|
Fig. 3.
A, [3H]ATMP binding to
varying concentrations of CK14. The mean values of duplicate analyses
at each concentration were plotted. The position of 350 pmol of CK14,
selected to study the specific binding of CK14 with ATMP is indicated
on the graph as a vertical dotted line. BSA is used as a
negative control. Inset provides the profile of synthetic
ATMP, with the amino acid sequence "PYPSYGYEPMGGW"
purified by C18-reversed phase HPLC. B, specific binding of
[3H]ATMP to CK14 as a function of increasing
concentration of ATMP-Scatchard plot analysis. The Scatchard analysis
of this specific binding is shown as an inset. Each point
represents the mean of duplicate determinations.
r2 and p values of the slope are
indicated in the graph.
|
|
ATMP but Not Mutations of ATMP Bind to CK14--
The binding of
CK14 to rM179 was assessed in Western blot before and after
preincubating CK14 with ATMP or loss of function mutations of ATMP. In
one of the two mutant ATMP peptides (T-ATMP), the third proline is
substituted with threonine, and in the other (F-ATMP) all three tyrosyl
residues are replaced by phenylalanine (the T-ATMP mutation has
been found in some cases of human X-linked amelogenesis imperfecta).
The binding of CK14 to rM179 is abrogated after pretreatment with ATMP
but not after pretreatment of CK14 with T-ATMP or F-ATMP suggesting
that mutated ATMP is not capable of binding to CK14 as does ATMP (Fig.
4).

View larger version (45K):
[in this window]
[in a new window]
|
Fig. 4.
Loss of function mutations of ATMP results in
loss of binding to CK14 as assessed by Western blot analysis.
Lanes 1-7, transblot from 12% gel. Lane 1, standards; Lane 2, rM179 stained with Fast Green;
Lanes 3-7 were immunostained with affinity purified, murine
monoclonal antibody for CK14 (clone LL002, 1/1000). Lane 3, CK14 after immunostaining. Lane 4, rM179 overlaid with CK14
alone stained. Lane 5, CK14 preincubated (for 1 h) with
ATMP did not stain. Lane 6, CK14 preincubated with T-ATMP
stained. Lane 7, CK14 preincubated with F-ATMP,
stained.
|
|
Morphometry and CK14 Distribution in Ameloblasts during Enamel
Formation--
To determine CK14-amelogenin interaction in
vivo during development, morphometry of enamel growth and the
distribution and migration of CK14 was studied. Enamel growth was
quantified by measuring the width of enamel in cross-sections of mouse
incisors from day 0 to 9. The height of the tooth is distinguished into four zones from the base of the tooth as 20, 40, 60, and 80%. Fig.
5 shows that the width of enamel
increases from day 1 to 5 at 60% level. It reaches a maximum on day 5 without much change thereafter on days 7 and 9. A similar pattern was
observed at the 40% level. The enamel width steadily increased until
day 7 and is constant thereafter. These morphometric observations
indicated that tooth development is initiated on day 0 and prolific on
day 3 and reaches a maximum between days 5 and 7 and ceases to increase after day 7. During the corresponding period, immunolocalization of
CK14 in ameloblasts was carried out using a affinity purified monoclonal antibody specific for the C-terminal region of CK14 (15).
Fig. 6 shows that CK14 is distributed
throughout the cytoplasm on day 0. The immunostaining is increased in
intensity at the apical region adjacent to the extracellular matrix on
day 1. Staining is intense in the Tomes' process. CK14 immunostaining
is maximum in the apical region on day 3. Such staining persisted until
day 5 but is lost on day 7 and thereafter, when the enamel has reached its maximum thickness.

View larger version (14K):
[in this window]
[in a new window]
|
Fig. 5.
Morphometry of enamel during tooth
development. The serial cross-sections (6 µm) obtained from the
whole length of mouse mandibular incisor (PN 0, 1, 3, 5, 7, and 9) was
taken as 100%. The sections were stained with Mallory's triple stain
and the width of enamel was measured at the 40 and 60% level from the
base of the incisor using the software program Image-Pro Plus 4.0 on
nine sections (three incisors from three mice) per day. Mean
(n = 9) and standard deviation (vertical
bar) are indicated.
|
|

View larger version (140K):
[in this window]
[in a new window]
|
Fig. 6.
Distribution and migration of CK14 in
ameloblasts during different stages of enamel formation.
Saggital sections (6 µm) of mouse mandibular molar of day 0 (newborn), days 1, 3, 5, 7, and 9 (post-natal) were
immunostained. A, negative control day 0 treated with IgG
isotype shows no immunostaining; B, negative control on day
1 treated with IgG isotype shows no immunostaining; C,
negative control, day 7 treated with IgG isotype shows no
immunostaining. D, day 0, horizontal arrows point
out the distribution of CK14 throughout the cytoplasm of ameloblasts
(am). Vertical arrows show increased staining
observed toward the periphery. E, day 1. Horizontal
arrows show CK14 staining intensity at the apical region adjacent
to the extracellular matrix. Long and vertical
arrows indicate Tomes' processes. Note that enamel secretion has
commenced. F, day 3. CK14 immunostaining is maximum at the
apical region (horizontal arrows). Enamel secretion is
evident. G, day 5 CK14 immunostaining is still intense at
the apical region (vertical arrows). Enamel matrix is
thickened. H, day 7 CK14 immunostaining declined
(arrows). The enamel has reached maximum thickness.
Horizontal bar refers to measurement. A, 20 µm; B, 20 µm; D, 20 µm;
E, 30 µm; F, 30 µm.
|
|
Co-localization of CK14 and Amelogenin--
Three complete
independent experiments were done using confocal microscopy. One for
CK14-FITC, another for amelogenin-TRITC, and a third for the
combination of the two dyes. Fig. 7
illustrates three fluorescent images of ameloblasts on day 0 with FITC
(green) signal only (Fig. 7A) or TRITC
(red) signal only (Fig. 7B) or with combination
of signals (Fig. 7C). Coassembly of CK14 and amelogenin is
indicated by the yellow signal (Fig. 7C). The
yellow granules (pixel) are distributed all around the
nucleus on day 0. Arrows indicate circular distribution or
aggregation of the granules in the cytoplasm. Green signal (CK14
+/amelogenin ) is seen at the distal end of the ameloblasts (Fig.
7C). Fig. 8 demonstrates
co-localization of CK14 and amelogenin in ameloblasts during different
stages of enamel growth. Accumulation of co-localized CK14-amelogenin
granules is observed in the apical region of ameloblasts on day 1 (Fig.
8C). Presence of yellow granules in the cytoplasm and
increasing density of the granules toward the apical region suggests
migration of co-assembled CK14 and amelogenin from the perinuclear
region to the apical end of the cell. The sections showed a distinct
green signal in the cytoplasm as well as in the distal region of
ameloblasts indicative of free CK14 on day 1. Fig. 8D shows
co-localization of CK14 and amelogenin on day 3. The accumulation of
co-localized CK14-amelogenin in the apical region of ameloblasts is
very prominent (yellow arrow). However, green signals were
also observed at the apical end (green arrows). Further
magnification (inset in Fig. 8D) revealed
a mixture of signals in the apical region of the ameloblasts (Fig.
8E). The signals were predominantly yellow (yellow
arrow). Green signals (dark green or green
arrows) are observed toward the interior of the apical zone of
ameloblast. Red signals (red arrows) are abundant toward the
exterior of the apical zone. While the yellow signal showed the
co-localization of CK14 and amelogenin, the red and green signals
signify the presence of (non-co-localized) free CK14 and amelogenin in
the apical zone. Free amelogenin (red signal) moves toward exterior
while free CK14 (green signal) remains or moves toward interior of the
ameloblasts. Fig. 8, F, G, and H, represent
co-localization and secretion of amelogenin on days 5, 7, and 9, respectively. On day 9 (Fig. 8H) amelogenin forms a distinct
layer at the formative zone of enamel. The yellow granules in the
cytoplasm (yellow arrow) are very few. Red and green
granules are also found in the disintegrating ameloblasts at days 7 and 9 (Fig. 8, G and H).

View larger version (39K):
[in this window]
[in a new window]
|
Fig. 7.
Co-localization of CK14 and amelogenin in
ameloblasts on day 0 as revealed by Lazer scan double-label confocal
fluorescence microscopy. Saggital sections (6 µm) were
sequentially stained and examined under confocal laser scan microscopy.
A, green (FITC) signal (514) refers to CK14 immunostaining.
Note the distribution of the granules throughout the cytoplasm of the
ameloblasts. Arrows indicate the distribution of the
cytoplasmic granules around the nucleus. B, red (TRITC)
signal (543) refers to amelogenin immunostaining. Note the distribution
of amelogenins in the cytoplasm. C, co-localization
of CK14 and amelogenin near the nucleus (n) of ameloblasts
is shown by a hybrid yellow signal
(CK14+/amelogenin+). Horizontal bar
refers to measurement. A, 30 µM;
B, 30 µM; C, 30 µM.
|
|

View larger version (128K):
[in this window]
[in a new window]
|
Fig. 8.
Co-localization, migration and dissociation
of CK14 and amelogenin in ameloblasts during enamel development.
Saggital sections of mouse postnatal mandibular molars at days 1, 3, 5, 7, and 9 were deparaffinized, rehydrated, and endogenous peroxidase
activity was blocked with 3% H2O2. The
sections were stained and examined as described in the legend to Fig.
9. Green (FITC) signal (514) refers to CK14 immunostaining
(CK14+/amelogenin ). Red (TRITC) signal (543)
refers to amelogenin immunostaining
(CK14 /amelogenin+) co-localization of CK14
and amelogenin is shown by a hybrid yellow signal
(CK14+/amelogenin+). A-C, day 1. Note the distribution and co-localization of CK14 and amelogenin toward
the secretary end of the ameloblast (am). There is a clear
and distinct accumulation of CK14+/amelogenin+
pixels at the apical end. Note also the presence of
CK14+/amelogenin as well as
CK14+/amelogenin+ pixels in the cytoplasm.
CK14 /amelogenin+ pixels are restricted to the
site of enamel secretion. D, day 3, accumulation of
CK14+/amelogenin+ pixels at the apical end.
Note the presence of CK14+/amelogenin pixels
(green arrow) in the apical region.
CK14 /amelogenin+ pixels appear as a layer at
the site of enamel (e) secretion. E, day 3, white rectangular insert seen in D is magnified
to show co-localization as well as dissociation of CK14 and amelogenin
at the zone of enamel secretion. Yellow arrow refers to
pixel indicative of co-localization
(CK14+/amelogenin+). Green arrows
indicate to pixels with green signal
(CK14+/amelogenin ). Red arrows
indicate pixels with red signal
(CK14 /amelogenin+). Note the presence of red
signal toward at the site of enamel formation. F, G, and
H, distribution of green, yellow, and red signals on days 5, 7, and 9, respectively. Note the gradual disruption and disintegration
of ameloblasts on these days. H, red signal is seen as a
distinct layer at the formative zone of enamel on day 9. Arrows in F, G, and H indicate the
presence of free CK14. Am, ameloblast; d,
dentine; e, enamel; n, nucleus. Horizontal
bar refers to measurement. A, 20 µm;
B, 20 µm; D, 20 µm; E, 30 µm;
F, 30 µm.
|
|
Collapse of Co-assembled CK14 and Amelogenin during
Amelogenesis--
Fig. 8E (magnification of
inset in 8D) provides evidence to suggest
collapse of coassembled CK14 and amelogenin after accumulation at the
apical region of ameloblasts by day 3. To verify whether such
dissociation occurs at the apical zone, free CK14 and amelogenin were
localized with [3H]ATMP and [3H]GMp. The
rational for this investigation is that the coassembly of CK14 and
amelogenin involves binding of ATMP (PYPSYGYEPMGGW) with the GMp of
CK14. Dissociation would expose these peptide sequences in CK14 and
amelogenin, which can be monitored using [3H]ATMP and
[3H]GMp. [3H]ATMP may bind to both GlcNAc
and GMp of CK14. The presence of GlcNAc is identified with D. stromonium lectin and wheat germ agglutinin (data not shown). The
staining indicated diffused distribution of GlcNAc containing
glycoconjugates in the cytoplasm of ameoloblasts toward the distal
zone. To eliminate the interaction of GlcNAc-glycoconjugates with
[3H]ATMP, autoradiography was performed after removing
the GlcNAc residues with N-acetylglucosaminidase (Fig.
9). The figure shows the localization of
free CK14 with [3H]ATMP at days 0, 1, and 3. [3H]ATMP was observed throughout the cytoplasm at all
days. On day 0, the free CK14 is abundant in the cytoplasm (Fig.
9A). Accumulation of free CK14 in the apical end is observed
on day 1 (Fig. 9, B and C). Concomitant with an
increase in enamel growth on day 3, free CK14 accumulated in the apical
region of ameloblasts, as evidenced by the increased accumulation of
[3H]ATMP. Fig. 10,
C and D, indicate accumulation of
[3H]ATMP within the Tomes' process on day 5. In
contrast, [3H]GMp failed to show such accumulation in the
apical region of the cytoplasm either on day 5 or 3 (Fig. 10,
A and E). However, magnification of the apical
region of the ameloblasts on day 5 revealed accumulation of
[3H]GMp within the Tomes' process and at the exterior of
the ameloblasts (Fig. 10B). These observations suggest that
the coassembled CK14-amelogenin may dissociate in the Tomes' process.
The free amelogenin moves out of ameloblasts, whereas free CK14 may
remain within the ameloblasts.

View larger version (132K):
[in this window]
[in a new window]
|
Fig. 9.
Binding of [3H]ATMP to free
CK14 in N-acetylglucosaminidase-treated
ameloblasts. Sections from mouse mandibular tooth organ (6 µm,
saggital sections) were treated with 50 milliunits of GlcNAcase to
assess the localization CK14 in ameloblasts during the enamel
formation. A, day 0. Arrows indicate binding of
ATMP to CK14 in the cytoplasm of ameloblasts. Note the uniform
distribution of [3H]ATMP in the cytoplasm. B,
day 1 early. Arrows indicate distribution of
[3H]ATMP (site of CK14) at the apical end of the
ameloblasts, the site of secretion of enamel. C, day 1, late. Arrows indicate accumulation of [3H]ATMP
(site of CK14) at the apical end of the ameloblasts. D, day
3. Arrows indicate intensity in the accumulation of
[3H]ATMP at the apical end of the ameloblasts.
Am, ameloblasts; e, enamel; d,
dentine; pd, predentine; si, stratum
intermedium.
|
|

View larger version (118K):
[in this window]
[in a new window]
|
Fig. 10.
Binding of [3H]GMp to free
amelogenins or [3H]ATMP to free CK14 at the Tomes'
process in ameloblasts. A, B, and E, binding
[3H]GMp to free amelogenins. On day 5 (A) and
on day 3 (E) no accumulation of [3H]GMp is
observed. Inset in A is magnified in B. Arrows indicate [3H]GMp, suggestive of free
amelogenin, in Tomes' process of ameloblasts. C and
D, binding [3H]ATMP on day 5 in
GlcNAcase-treated sections. Inset is magnified in
D and the arrows indicate [3H]ATMP,
suggestive of free-CK14, in Tomes' process of ameloblasts.
|
|
Quantitation of Co-localized and Free Amelogenin and CK14--
To
evaluate co-assembly and dissociation of CK14 and amelogenin the
percentage of green, yellow, and red signals (pixels) were measured
during the growth of enamel at different days of development of teeth
(Fig. 11).

View larger version (15K):
[in this window]
[in a new window]
|
Fig. 11.
Quantitation of CK14-amelogenin paired
pixels during different stages of development using confocal laser scan
microscopy. The quantitation is based on the analyses of the
scatter diagram (co-localization) obtained with confocal laser scan
microscopy. All pixels having the same positions in both images are
considered a pair. Of every pair of pixels (P1, P2) from the two
images, the brightness level of pixel P1 is interpreted as X
coordinate, and that of pixel P2 as Y coordinate of the
scatter diagram. Non-co-localized P1 and P2 pixels and the background
values were excluded to distinguish the pixels that are co-localized.
The results were expressed as percentage of co-localization of
amelogenins and CK14 at different developmental stages from day 0 to 9 from initiation, growth, and cessation (double-head arrows)
of enamel formation. The quantity of non-co-localized P1 and P2 pixels
representing free amelogenin and free CK14, respectively, are also
plotted for comparison.
|
|
The level of free cytokeratin within ameloblast as evidenced by the
green signal appeared constant throughout and remained <20%. Free
amelogenin (red signal) in ameloblast increased on day 3. This finding
suggests that the dissociation of the CK14-amelogenin assembly may
commence on day 3. The decline and the steady-state level of free
amelogenin (red signals) between days 3 and 7 could be due to
continuous and prolific secretion of amelogenin. The quantitative
variation of co-assembled amelogenin-CK14 within ameloblasts showed a
pattern concomitant with enamel growth. The yellow granules although
abundant on day 0 tend to decline on day 3 concomitant with increase in
free amelogenin (red signals). The decrease in the percent of pixels on
day 3 could be due to the accumulation of the granules. Increase in
co-localized granules on days 5 and 7 are consistent with enamel growth
during this period. It also suggests active synthesis and transport of
nascent amelogenin polypeptides to the sites of secretion.
 |
DISCUSSION |
Properties of the N-terminal "Head" Region of
CK14--
Expression of cytokeratin is specific for each epithelial
cell type and its state of differentiation (32). CK14, a member of the
family of acidic type I cytokeratins, consists of a conserved rod
domain with four -helical regions separated by short non-helical linker sequences and flanked by non-helical globular sequences commonly
referred to as head (N-terminal) and tail (C-terminal) domains (33).
Self-assembly of CK14 leads to formation of intermediate filaments of
10 nm diameter. The self-assembly is facilitated by the -helical
region (33). Removal of the head domain does not affect self-assembly
(34) suggesting that the head region may have a role different from
that of CK14 self-assembly, which is necessary for formation of the
cytoskeleton or intermediate filaments. The presence of the GMp
sequence in the head region of CK14 favors a role in binding to
GlcNAc-binding lectins. Indeed, the ATMP motif of the N-terminal domain
of amelogenins, that specifically binds to GlcNAc residues (10), also
recognizes the GMp sequence (11). The binding specificity of the ATMP
sequence (PYPSYGYEPMGGW) to the GMp motif (SFGSGFGGGY) was confirmed by
dosimetric binding of amelogenin or TRAP with [3H]GMp,
specific binding in varying concentrations of labeled GMp, Scatchard
plot analysis, and competitive inhibition with unlabeled GMp (11).
These findings lend support to the binding capability of the ATMP motif
of amelogenins with the GMp sequence in the N-terminal head region of CK14.
Specificity of Amelogenin-CK14 Interaction and the Biological
Significance--
The dosimetric interaction between CK14 and
amelogenin (Fig. 1A), CK14 and TRAP (Fig. 1B),
and CK14 and the ATMP motif (Fig. 2) further favor the
sequence-sequence interaction between the two proteins. Inability
of amelogenin to bind to CK14, if blocked by GlcNAc or GMp sequence and
inhibition of CK14 binding to amelogenin by ATMP (Table I), confirms
the sequence-sequence interaction between the ATMP motif of amelogenins
and the GMp motif of CK14. The possible biological significance of
amelogenin-CK14 interaction is revealed by the loss of function
mutations of ATMP (T-ATMP and F-ATMP) failing to interact with CK14.
One of these mutations involves substitution of the third proline with
threonine as has been reported in the inherited enamel defect of human
amelogenesis imperfecta (12). Similarly, substitution of tri-tyrosyl
residues with phenylalanine affected the binding of ATMP with CK14,
suggesting that mutational alterations of the ATMP sequence that cause
enamel defects could be due to loss of binding of the mutant amelogenin to CK14 and a consequent inability of the amelogenin to reach the site
of secretion. Thus, CK14 may play an important role in amelogenesis by
interacting with the ATMP motif of amelogenin. The immunofluorescence
studies made in this investigation suggest a possible role of CK14 in amelogenesis.
CK14 and Amelogenin as Ameloblast-differentiation
Markers--
While amelogenin is the postnatal differentiation marker
of ameloblasts, the presence of CK14 in ameloblasts 48-96 h earlier than the expression of amelogenin indicates that CK14 is a
stage-specific differentiation marker for ameloblasts (3). Morphometric
measurements of developing enamel define the stage-specific secretion
of the enamel matrix by ameloblasts. Three phases of enamel formation can be distinguished at different levels of a growing murine incisor tooth. Enamel secretion commences (stage I) on day 0 and remains slow
until day 1. Phase II commences after day 1 when the enamel growth is
prolific by day 3 and reaches a maximum between days 5 or 7 (Fig. 5).
In phase III enamel growth ceases and ameloblasts lose their
distinctive morphology. Correlated with sequential development of
enamel formation, a change in the pattern of distribution of CK14 is
observed in ameloblasts. While CK14 immunostaining is highly prevalent
in the perinuclear region, the migration of CK14 to the apical region
of the cell from day 1 is evident in both light and confocal
microscopy. Intense fluorescent green signal, at dual wavelengths in
confocal microscopy, at the distal region of ameloblasts provides
evidence of self-assembly of CK14. Amelogenin is also found around the
perinuclear region of ameloblasts on days 1 to 3, but amelogenin is
always co-assembled with CK14.
Co-assembly of Amelogenin and CK14 during Enamel
Formation--
Co-localization of CK14-amelogenin was evident by the
yellow signal or pixels in confocal microscopy (Fig. 7). Absence of red
signals at dual wavelengths on day 0 in the cytoplasm suggests either
the absence of free amelogenin or masking of amelogenin by CK14. The
perinuclear distribution of yellow granules in the cytoplasm of
ameloblasts on day 0 indicates a co-localization of CK14 and
amelogenin. Progressive accumulation of the same granules at the apical
region of ameloblasts from days 1 to 3 suggests co-migration of the
CK14-amelogenin complex from the perinuclear region to the apical
region. Co-localization of CK14-amelogenin is prominently seen at the
apical region until day 5.
Co-assembly of CK14-Amelogenin Is Transient--
During the
prolific phase (phase II) of enamel matrix secretion between days 3 and
5 (Fig. 8E), three distinct signals are observed at the
apical zone. They are yellow signals indicative of co-assembly of
CK14-amelogenin, emigrating or red signals indicative of free
amelogenin, and retention or green signals indicative of free CK14. The
augmentation of the red signal outside the periphery of ameloblasts on
day 7 as a distinct layer of red signal at the interphase between the
apical region of ameloblasts and enamel matrix indicates newly secreted
extracellular amelogenin that is yet to undergo postsecretory
modifications. All these observations suggest that amelogenin may be
translocated from the site of synthesis in the perinuclear region to
the apical region of the cell in association with CK14, and at the
apical region the dissociation of the co-assembly complex of
CK14-amelogenin may occur, prior to amelogenin secretion.
Evidence for Dissociation of Co-assembled
CK14-Amelogenin--
While confocal microscopy indicated
co-distribution and co-migration of CK14-amelogenin, autoradiographic
studies with [3H]ATMP provided information on the
dissociation of the amelogenin-CK14 complex. Free CK14 is restricted
within the ameloblast as evidenced by the distribution of
[3H]ATMP. Accumulation of free CK14 at the apical region
of ameloblasts commenced early on day 1 and increased on day 3 and
remained constant until day 5. On the other hand, no prominent
accumulation of radiolabeled GMp could be seen in the apical region of
ameloblasts. However, upon magnification, a specific accumulation of
[3H]GMp is observed in the apical cytoplasmic projections
(Tomes' process) of the ameloblasts. Further examination revealed that [3H]ATMP is also seen in the same region, suggesting that
these apical cellular projections of the ameloblasts are a specialized zone of the cytoplasm facilitating the dissociation of CK14-amelogenin complex.
Transient Co-expression between Cytokeratins and Other
Proteins--
Similar to co-expression of CK14 and amelogenin,
transient coexpression of cytokeratins and vimentin was observed during
ontogenic development (4), in the cornea (4), fetal tongue epithelia (35), and in an adenomatoid odontogenic tumor (36). Interestingly such
co-expression of cytokeratin and vimentin in epithelial cells is
considered a typical feature of a proliferative situation and the
secretory functions of vimentin (4). Robinson and co-workers (37)
envisaged a similar interaction between tuft proteins and keratins in
ameloblasts during enamel formation. Although none of these
investigations documented sequence-sequence interaction between
cytokeratin and vimentin or tuft proteins, it appears such
coexpressions are in many cases not random but are intrinsic and cell
type related. Several proteins have been identified to be associated
with cytokeratins (38). A list of such cytokeratin-associated proteins
is presented in Table II. Most of these
proteins are associated with the C-terminal end of cytokeratins but no
specific sequence-sequence interaction was established.
Significance of CK14-Amelogenin Interaction--
The observations
that amelogenin binds specifically to GlcNAc (10) led to a study of its
interaction with the GMp (11). The finding that the sequence of GMp has
100% homology with CK14 but not with any other known proteins or
ameloblasts (present study) and that CK14 is a differentiation marker
of ameloblasts before synthesis of amelogenin (3) led to the
serendipitous findings reported in this investigation. The biological
significance of the CK14-amelogenin association may not only be
significant, in promoting translocation of amelogenin to the site of
secretion but may also serve as a repressor of co-assembly and
migration of CK14-amelogenin and amelogenesis, as in the cases of
X-linked inherited diseases like amelogenesis imperfecta. This finding contrasts to our earlier assumption that mutations at the ATMP site may
affect post-secretory interactions of amelogenin. Similarly, mutations
at the GMp site of CK14 may also suppress the secretion of amelogenin.
In support of this concept Rugg et al. (39) have reported
the presence of discolored and notched front teeth in a child with
a functional "knockout" of CK14, displaying clinical symptoms of
epidermolysis bullosa. However, amelogenins mutated at sites other than
the ATMP and non-GMp mutations of CK14 may not affect the co-assembly
and migration of CK14-amelogenin.
In conclusion, our investigation appears unique in documenting a
specific sequence-sequence interaction between CK14 and amelogenins. Based on this interaction between amelogenins and CK14 and their co-assembly, distribution, migration, and dissociation of the co-assembled proteins, we envisage that the functional role of CK14 may
be similar to heat shock proteins (40) in binding to nascent peptides
and carrying them to the cell surface. Our observations reveal that the
ATMP motif at the N-terminal region of amelogenins function as a
signal peptide for GMp-ligand of CK14 and CK14 may perform a
chaperon role during amelogenesis. A schematic for the putative role of
CK14 during amelogenesis is presented in Fig. 12. An additional point of note is that
it has been shown that cytokeratin-associated proteins may become
dissociated following phosphorylation of the associated protein (38).
In this context it is of interest that serine 16 is phosphorylated in
the native amelogenins extracted from the enamel, although evidence for
the presence of a non-phosphorylated entity has also been reported (41). It remains unclear whether amelogenin phosphorylation contributes
to the dissociation of the amelognein-CK14 complex prior to amelogenin
secretion. A study of the enzymes involved in serine phosphorylation in
the apical region of ameloblasts, particularly in the Tomes' process
is under investigation.

View larger version (25K):
[in this window]
[in a new window]
|
Fig. 12.
Scheme of the putative functional role for
CK14 in amelogenesis. CK14 binds to the ATMP motif of the
N-terminal region of the nascent amelogenin polypeptide in the
perinuclear region. ATMP motif serves as a signal peptide. The GMp
motif at the N-terminal region of CK14 acts as ligand to bind to the
signal peptide and form a co-assembly. Co-assembled CK14-amelogenin
migrates to the Tomes' process, where collapse of co-assembly of
CK14-amelogenin occurs resulting in release of amelogenin.
Phosphorylation (P) at the serine residue of amelogenin suggests that
it may facilitate the dissociation of amelogenin from CK14.
|
|
 |
ACKNOWLEDGEMENTS |
We thank Dr. Charles F. Shuler, Chairman,
Center for Craniofacial Molecular Biology, University of Southern
California, for encouragement and support, and Ernesto Barron at the EM
core facility at Doheny EYE institute for assistance in confocal laser
scanning microscopy.
 |
FOOTNOTES |
*
This work was supported by National Institutes for Health
NIDR Grant DE-03660.The costs of publication of this
article were defrayed in part by the
payment of page charges. The article
must therefore be hereby marked
"advertisement" in
accordance with 18 U.S.C. Section
1734 solely to indicate this fact.
To whom correspondence should be addressed: Center for
Craniofacial Molecular Biology, School of Dentistry, University of Southern California, 2250 Alcazar St., Los Angeles, CA 90033. Tel.:
323-442-3171; Fax: 323-442-2981; E-mail: rravindr@hsc.usc.edu.
Published, JBC Papers in Press, June 25, 2001, DOI 10.1074/jbc.M104656200
 |
ABBREVIATIONS |
The abbreviations used are:
ATMP, amelogenin
tri-tyrosyl motif peptide;
CK, cytokeratin;
TRAP, tyrosine-rich
amelogenin polypeptide;
LRAP, leucine-rich amelogenin polypeptide;
T-ATMP, where proline is substituted by threonine;
F-ATMP, where all
three tyrosyl residues are replaced by phenylalanine;
HPLC, high
performance liquid chromatography;
NB, newborn;
PN, post-natal;
GlcNAc, N-acetyl-D-glucosamine;
GMp, GlcNAc mimicking
peptide;
PVDF, polyvinylidene difluoride;
HSA, human serum albumin;
FITC, fluorescein isothiocyanate;
TRITC, tetramethylrhodamin
isothiocyanate;
ELISA, enzyme-linked immunosorbent assay;
PBS, phosphate-buffered saline.
 |
REFERENCES |
| 1.
|
Eastoe, J. E.
(1979)
J. Dent. Res.
58,
753-764
|
| 2.
|
Fincham, A. G.
(1998)
Connect. Tissue Res.
38,
1-304
|
| 3.
|
Tabata, M. J.,
Matsumura, T.,
Liu, J. G.,
Wakisaka, S.,
and Kurisu, K.
(1996)
Arch. Oral Biol.
41,
1019-1027
|
| 4.
|
Kasper, M.,
Karsten, U.,
Stosiek, P.,
and Moll, R.
(1989)
Differentiation
40,
207-214
|
| 5.
|
Domingues, M. G.,
Jaeger, M. M.,
Araujo, V. C.,
and Araujo, N. S.
(2000)
Eur. J. Oral Pathol.
108,
43-47
|
| 6.
|
Termine, J. D.,
Belcourt, A. B.,
Miyamoto, M. S.,
and Conn, K. M.
(1980)
J. Biol. Chem.
255,
9769-9772
|
| 7.
|
Fincham, A. G.,
Belcourt, A. B.,
Termine, J. D.,
Butler, W. T.,
and Cothran, W. C.
(1983)
Biochem. J.
211,
149-154
|
| 8.
|
Akita, H.,
Fukae, M.,
Shimoda, S.,
and Aoba, T.
(1992)
Arch. Oral Biol.
37,
953-962
|
| 9.
|
Fincham, A. G.,
Moradian-Oldak, J.,
and Simmer, J. P.
(1999)
J. Struct. Biol.
126,
270-299
|
| 10.
|
Ravindranath, R. M. H.,
Moradian-Oldak, J.,
and Fincham, A. G.
(1999)
J. Biol. Chem.
274,
2464-2471
|
| 11.
|
Ravindranath, R. M. H.,
Tam, W.,
Nguyen, P.,
and Fincham, A. G.
(2000)
J. Biol. Chem.
275,
39654-39661
|
| 12.
|
Collier, P. M.,
Sank, J. J.,
Rosenbloom, J.,
Yuan, Z. A.,
and Gibson, C. W.
(1997)
Arch. Oral Biol.
42,
235-242
|
| 13.
|
Simmer, J. P.,
Lau, E. C.,
Hu, C. C.,
Aoba, T.,
Lacey, M.,
Nelson, D.,
Zeichner-David, M.,
Snead, M. L.,
Slavkin, H. C.,
and Fincham, A. G.
(1994)
Calcif. Tissue Int.
54,
312-319
|
| 14.
|
Merrifield, B.
(1996)
Science
232,
341-347
|
| 15.
|
Perkins, W.,
Campbell, I.,
Leigh, I. M.,
and Mackie, R. M. J.
(1992)
J. Cutaneous. Pathol.
19,
476-482
|
| 16.
|
Ravindranath, M. H.,
Ravindranath, R. M. H.,
Morton, D. L.,
and Graves, M. C. J.
(1994)
Immunol. Methods
169,
257-272
|
| 17.
|
Ravindranath, R. M. H.,
Mondino, B. J.,
Adamu, S. A.,
Halabi, H. P.,
Hasan, S. A.,
and Glasgow, B. J.
(1995)
Invest. Ophthalmol. Vis. Sci.
36,
2482-2491
|
| 18.
|
Ravindranath, R. M. H.,
Hasan, S. A.,
and Mondino, B. J.
(1997)
Curr. Eye Res.
16,
1036-1043
|
| 19.
|
Laemmli, U. K.
(1970)
Nature
227,
680-685
|
| 20.
|
Towbin, H.,
Staehelin, T.,
and Garden, J.
(1979)
Proc. Natl. Acad. Sci. U. S. A.
76,
4350-4354
|
| 21.
|
Ravindranath, R. M. H.,
and Graves, M. C.
(1992)
Virology
188,
143-151
|
| 22.
|
Ravindranath, R. M. H.,
and Graves, M. C.
(1990)
J. Virol.
64,
5430-5440
|
| 23.
|
Nakamura, M.,
Bringas, P., Jr.,
Nanci, A.,
Zeichner-David, M.,
Ashdown, B.,
and Slavkin, H. C.
(1994)
Anat. Record.
238,
383-396
|
| 24.
|
Zeichner-David, M.,
Vo, H.,
Tan, H.,
Diekwisch, T.,
Berman, B.,
Thiemann, F.,
Alcocer, M. D.,
Hsu, P.,
Wang, T.,
Eyna, J.,
Caton, J.,
Slavkin, H. C.,
and MacDougall, M.
(1997)
Int. J. Dev. Biol.
41,
27-38
|
| 25.
|
Leenders, G. V.,
Dijkman, H.,
Hulsbergen-van de Kaa, C.,
Ruiter, D.,
and Schalken, J.
(2000)
Lab. Invest.
80,
1251-1258
|
| 26.
|
Yu, W. H., Yu, S. C.,
Meng, Q.,
Brew, K.,
and Woessner, J. F., Jr.
(2000)
J. Biol. Chem.
275,
31226-31232
|
| 27.
|
Lacoste, T. D.,
Michalet, X.,
Pinaud, F.,
Chemla, D. S.,
Alivisatos, A. P.,
and Weiss, S.
(2000)
Proc. Natl. Acad. Sci. U. S. A.
97,
9461-9466
|
| 28.
|
Trivedi, N. S.,
Wang, H. W.,
Nieminen, A. L.,
Oleinick, N. L.,
and Izatt, J. A.
(2001)
Photochem. Pathobiol.
71,
634-650
|
| 29.
|
Peters, B. P.,
Ebisu, S.,
Goldstein, I. J.,
and Flashner, M.
(1979)
Biochemistry.
18,
5505-5511
|
| 30.
|
Shibuya, N.,
Goldstein, I. J.,
Broekaert, W. F.,
Nsimba-Lubaki, M.,
Peters, B.,
and Peumans, W. J.
(1987)
J. Biol. Chem.
262,
1596-1601
|
| 31.
|
Yamashita, K.,
Totani, K.,
Ohkura, S.,
Takasaki, S.,
Goldstein, I. J.,
and Kobata, A.
(1987)
J. Biol. Chem.
262,
1602-1607
|
| 32.
|
Moll, R.,
Franke, W. W.,
and Schiller, D. D.
(1982)
Cell.
31,
11-24
|
| 33.
|
Fuchs, E.,
and Weber, K.
(1994)
Annu. Rev. Biochem.
63,
345-382
|
| 34.
|
Coulombe, P.,
and Fuchs, E.
(1990)
J. Cell Biol.
111,
153-169
|
| 35.
|
Van Muijen, G. N. P.,
Ruiter, D. J.,
Franke, W. W.,
Achtstatter, T.,
Haasnoot, W. H. B.,
Ponec, M.,
and Warnaar, S. O.
(1986)
Exp. Cell. Res.
162,
97-113
|
| 36.
|
Tatemoto, Y.,
Tanaka, T.,
Okada, Y.,
and Mori, M.
(1988)
Virchows Arch. A Pathol. Anat.
413,
341-347
|
| 37.
|
Robinson, C.,
Lowe, N. R.,
and Weatherell, J. A.
(1977)
Calcif. Tissue Res.
23,
19-31
|
| 38.
|
Foisner, R.,
and Wiche, G.
(1991)
Curr. Opin. Cell Biol.
3,
75-81
|
| 39.
|
Rugg, E. L.,
McLean, W. H. I.,
Lane, E. B.,
Pitera, R.,
McMillan, J. R.,
Dopping-Hepenstal, P. J.,
Navasaria, H. A.,
Leagh, I. M.,
and Eady, R. A. J.
(1994)
Genes Dev.
8,
2563-2573
|
| 40.
|
Georgopoulos, C.,
and Welch, W. J.
(1993)
Annu. Rev. Cell Biol.
9,
601-634
|
| 41.
|
Fincham, A. G.,
Moradian-Oldak, J.,
and Sarte, P. E.
(1994)
Calif. Tissue Int.
55,
398-400
|
| 42.
|
Foisner, R.,
and Wiche, G.
(1987)
J. Mol. Biol
198,
515-531
|
| 43.
|
Foisner, R.,
Leichtfried, F. E.,
Herrmann, H.,
Small, J. V.,
Lawson, D.,
and Wiche, G.
(1988)
J. Cell Biol
106,
723-733
|
| 44.
|
Wiche, G.
(1989)
Crit. Rev. Biochem. Mol. Biol
24,
41-67
|
| 45.
|
Resing, K. A.,
Walsh, K. A.,
Haugen-Scofield, J.,
and Dale, B. A.
(1989)
J. Biol. Chem
264,
1837-1845
|
| 46.
|
Green, K. J.,
Parry, D. A.,
Steinert, P. M.,
Virata, M. L.,
Wagner, R. M.,
Angst, B. D.,
and Nilles, L. A.
(1990)
J. Biol. Chem
265,
2603-2612
|
| 47.
|
Mehrel, T.,
Hohl, D.,
Tothnagel, J. A.,
Longley, M. A.,
Bundman, D.,
Cheng, C.,
Lichti, U.,
Bisher, M. E.,
Steven, A. C.,
Steinert, P. M.,
and Yuspa, S. H.
(1990)
Cell
61,
1103-1112
|
| 48.
|
Fliegner, K. H.,
Ching, G. Y.,
and Liem, R. K.
(1990)
EMBO J
9,
749-755
|
| 49.
|
Lendahl, U.,
Zimmerman, L. B.,
and McKay, R. D. G.
(1990)
Cell
60,
585-595
|
| 50.
|
Cartand, A.,
Ludosky, M. A.,
Courvalin, J. C.,
and Carland, J. A.
(1990)
J. Cell Biol
111,
581-588
|
| 51.
|
Foisner, R.,
and Wiche, G.
(1991)
Curr. Opin. Cell Biol
3,
75-81
|
Copyright © 2001 by The American Society for Biochemistry and Molecular Biology, Inc.

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
This article has been cited by other articles:

|
 |

|
 |
 
Y Kabasawa, K Nagumo, Y Takeda, N Kawashima, N Okada, K Omura, A Yamaguchi, and K Katsube
Amelogenin positive cells scattered in the interstitial component of odontogenic fibromas
J. Clin. Pathol.,
July 1, 2008;
61(7):
851 - 855.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. M. H. Ravindranath, A. Devarajan, and T. Uchida
Spatiotemporal Expression of Ameloblastin Isoforms during Murine Tooth Development
J. Biol. Chem.,
December 14, 2007;
282(50):
36370 - 36376.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. Hatakeyama, D. Philp, Y. Hatakeyama, N. Haruyama, L. Shum, M.A. Aragon, Z. Yuan, C.W. Gibson, T. Sreenath, H.K. Kleinman, et al.
Amelogenin-mediated Regulation of Osteoclastogenesis, and Periodontal Cell Proliferation and Migration
Journal of Dental Research,
February 1, 2006;
85(2):
144 - 149.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. M. H. Ravindranath, R. M. Basilrose Sr., N. H. Ravindranath, and B. Vaitheesvaran
Amelogenin Interacts with Cytokeratin-5 in Ameloblasts during Enamel Growth
J. Biol. Chem.,
May 23, 2003;
278(22):
20293 - 20302.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Santos, A. Bravo, C. Lopez, J. M. Paramio, and J. L. Jorcano
Severe Abnormalities in the Oral Mucosa Induced by Suprabasal Expression of Epidermal Keratin K10 in Transgenic Mice
J. Biol. Chem.,
September 13, 2002;
277(38):
35371 - 35377.
[Abstract]
[Full Text]
[PDF]
|
 |
|
Copyright © 2001 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|