JBC

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Originally published In Press as doi:10.1074/jbc.M106101200 on February 5, 2002

J. Biol. Chem., Vol. 277, Issue 20, 17962-17969, May 17, 2002
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
277/20/17962    most recent
M106101200v1
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Shariat-Madar, Z.
Right arrow Articles by Schmaier, A. H.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Shariat-Madar, Z.
Right arrow Articles by Schmaier, A. H.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Identification and Characterization of Prolylcarboxypeptidase as an Endothelial Cell Prekallikrein Activator*

Zia Shariat-MadarDagger , Fakhri MahdiDagger , and Alvin H. SchmaierDagger §

From the Division of Hematology and Oncology, Departments of Dagger  Internal Medicine and § Pathology, University of Michigan, Ann Arbor, Michigan 48109-0640

Received for publication, July 1, 2001, and in revised form, February 2, 2002

    ABSTRACT
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Our recent investigations have postulated a human umbilical vein endothelial cell (HUVEC)-associated prekallikrein activator (PKA). When prekallikrein (PK) assembles on high molecular weight kininogen on HUVEC, PK is activated to kallikrein. PKA was found in the 15,800 × g pellet of HUVEC lysates using an assay that measures PK activation only when bound to high molecular weight kininogen linked to microtiter plates. Sequential DEAE, wheat germ lectin affinity, and hydroxyapatite chromatography resulted in four protein bands on SDS-PAGE. One protein in the 73-kDa band was identified by amino acid sequencing as prolylcarboxypeptidase (PRCP). On gel filtration, PKA activity was a single homogenous peak identical in migration to the 73-kDa immunoblot of PRCP. Anti-PRCP inhibits PKA activity and PK activation on HUVEC. Purified PKA was blocked by diisopropyl fluorophosphate (1 mM), phenylmethylsulfonyl fluoride (3 mM), leupeptin (100 µM), antipain (IC50 = 2 µM), HgCl2 (IC50 = 500 µM), Z-Pro-Pro-aldehyde-dimethyl acetate (IC50 = 1 µM), and corn trypsin inhibitor (IC50 = 40 nM). PKA did not correct the coagulant defect in factor XII deficient plasma, was purified from HUVEC cultured in factor XII-deficient serum, was not detected by antibody to factor XII, did not activate FXI, and was not inhibited by a neutralizing antibody to FXII. Angiotensin II (IC50 = 2 µM) or bradykinin (IC50 = 100 µM), but not angiotensin II-(1-7) or bradykinin1-5, and the prolyl oligopeptidase inhibitor Fmoc-Ala-Pyr-CN (IC50 = 50 nM) also blocked purified PKA activation of PK. The Km of PK activation by PRCP is 6.7 nM. PRCP antigen is present on the membrane of fixed but not permeabilized HUVEC. PRCP appears to be a HUVEC-associated PK activator.

    INTRODUCTION
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

The physiologic initiator of activation of the plasma kallikrein/kinin system has not been identified. Recent evidence indicates that the assembly of prekallikrein (PK)1 and high molecular weight kininogen (HK) on endothelial cells results in kallikrein formation that is blocked by antipain (1-3). On endothelial cells, HK assembles on a multiprotein receptor that consists of at least gC1qR, urokinase plasminogen activator, and cytokeratin-1 (4-8). Moreover, cytokeratin-1 colocalizes on endothelial cells with urokinase plasminogen activator but not gC1qR (9).

HK, the parent protein for bradykinin, is found primarily in plasma and some tissues (10). The majority of plasma PK and factor XI (FXI) circulates in a complex with HK allowing HK bound to its multiprotein receptor to serve as the PK and FXI receptor on endothelial cells (3, 11, 12). Activation of FXI on endothelial cells requires factor XIIa (FXIIa), either added exogenously or derived endogenously from the bovine enzyme present in bovine serum in the culture medium (12). Alternatively, PK activation on endothelial cells occurs in the absence of endogenous or exogenous FXII or its activated forms (3). FXII does not autoactivate on endothelial cells as fast as PK activation when PK is assembled on HK (13). However, activated FXII associated with endothelial cells amplifies PK activation (14). These combined data suggest that there is a prekallikrein activator (PKA) associated with endothelial cells in culture independent of factor XIIa. These investigations show that the serine protease prolylcarboxypeptidase (PRCP) (lysosomal carboxylpeptidase, angiotensinase C), an enzyme of the renin-angiotensin system, is an endothelial cell PK activator.

    EXPERIMENTAL PROCEDURES
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Materials-- Frozen human umbilical vein endothelial cells (HUVEC), endothelial cell growth medium, trypsin-EDTA, and trypsin neutralizing buffer were purchased from Clonetics (San Diego, CA). Wheat germ immobilized on 6% agarose-macrobeads, CM Cellulose, SP-Sephadex, and hydroxyapatite (calcium phosphate hydroxide, Type 1) were obtained from Sigma. DEAE (diethylaminoethyl)-cellulose was purchased from Whatman. Triton X-100 was purchased from Roche Molecular Biochemicals. Prestained and low molecular weight standards, nitrocellulose, polyacrylamide, and Biobeads SM2 were purchased from Bio-Rad. HK, PK, corn trypsin inhibitor, plasma kallikrein, and antibody to human factor XII were purchased from Enzyme Research Laboratory (South Bend, IN). HD-Pro-Phe-Arg-paranitroanilide (S2302) was from DiaPharma (Franklin, OH). Peptides angiotensin II, angiotensin II- (1-7), bradykinin, bradykinin-(1-5), mercuric chloride, iodoacetic acid, iodoacetamide, N-ethylmaleimide, o-phenanthroline, leupeptin, and benzamidine were purchased from Sigma. Antipain and phenylmethylsulfonyl fluoride (PMSF) were obtained from Calbiochem. Antibody to LAMP1 was obtained from Developmental Studies Hybridoma Bank, University of Iowa, Iowa City. Monoclonal antibody (HKL16) to the PK binding site on HK was generously provided by Dr. Werner Muller-Esterl, Frankfurt, Germany. Peptide SDD31 (S565DDDWIPMDIQTDPNGLSFNPISDFPDTTSPK595) from HK domain 6, which is the PK binding site on HK, was synthesized at Multiple Peptide Systems, San Diego, CA (12). Peptides K66TFNQRYLVADKYWKK81 and R479HMKNWIRDFYDSAGKQH496 from mature PRCP were synthesized and used to prepare antisera in goats by QCB Biochemicals, Hopkinson, MA.

PK Activator Assay-- The activity of the endothelial cell prekallikrein activator was determined in a solid phase assay. PKA activity was measured in 100-µl reaction mixtures consisting of enzyme in cell lysate or purified protein in HEPES-carbonate buffer (HCB) (137 mM NaCl, 3 mM KCl, 12 mM NaHCO3, 14.7 mM HEPES, 5.5 mM dextrose and 0.1% gelatin, pH 7.1, containing 10 µM CaCl2, and 1 mM MgCl2). In preparation for the assay, HK in 0.1 M Na2CO3, pH 9.6, was linked to a 96-well microtiter plate by overnight incubation at 4 °C. Preliminary experiments revealed that linking HK in such a manner did not result in its proteolysis, and the amount of HK linked to microtiter plate was constant from experiment to experiment. After incubation, the wells were washed with HCB and then blocked with 1% gelatin. Samples containing endothelial cell lysate or partially purified enzyme were added in 100-µl aliquots to the cuvette wells in HCB containing 20 nM PK and incubated for 1 h at 37 °C. Triton X-100 in cell lysates was removed using Bio-Beads SM2 adsorbent (Bio-Rad). After incubation, the wells were washed to remove unbound activator and PK, and the enzyme reaction was initiated by the addition of 100 µl of S2302 (0.8 mM). Activation of PK was observed at 405 nm for 1 h at 37 °C. The amount of kallikrein formed in the presence of the activator was determined by comparing it with the hydrolysis of S2302 by known amounts of plasma kallikrein (0.01-2.0 nM) in HCB for 1 h. Only 20% of the added substrate was hydrolyzed under the conditions of the assay, and the substrate hydrolysis was linear for an incubation time up to 120 min.

Endothelial Cell Culture-- HUVEC were obtained and cultured in growth medium containing bovine brain extract according to the recommendations of the manufacturer (Clonetics). Cells between the first and third passages were subcultured onto fibronectin-treated T-175 flasks 2 days prior to the start of the experiment as reported previously (12). Cell viability was determined using trypan blue exclusion.

Extraction and Purification of Endothelial Cell PKA from Human Umbilical Vein Endothelial Cells-- The entire purification process was performed at 4 °C. 50-100 flasks (T-175) of confluent monolayers of HUVEC (20-50 mg total protein) in passage 2 or 3 were removed and homogenized for three rounds of 20 strokes each with a hand homogenizer in 5 volumes of homogenizing buffer (50 mM NaCl, 10 mM Tris-HCl, pH 7.4, 0.5 mM EGTA). The crude homogenate was then centrifuged for 10 min at 1,200 × g, and the supernatant was collected. The pellet was re-homogenized in 3 volumes of homogenizing buffer, and its supernatant was combined with the first supernatant. The combined supernatants were then centrifuged for 20 min at 15,800 × g. The resulting pellet was dissolved in 10 ml of 0.3% Triton X-100 in homogenizing buffer, and the detergent/membrane mixture was gently rocked for 40 min at 4 °C. The mixture was then centrifuged for 60 min at 105,000 × g. The supernatant was the Triton X-100-solubilized granule-vesicular fraction of the 15,800 × g pellet. Its pellet was Triton X-100-insoluble granule-vesicular membrane proteins. The Triton X-100-solubilized granule-vesicular fraction, and not its pellet or the supernatant of the 15,800 × g centrifugation, contained most of the PKA activity and was subjected to further purification.

A DEAE-cellulose column was packed and equilibrated in 10 mM Tris-HCl, pH 7.4, 0.05 M NaCl containing 0.01% Triton X-100, 0.5 mM EGTA. The Triton X-100-solublized 15,800 × g pellet was loaded onto the DEAE column (1 × 10 cm). After sample loading, the column was washed with 30 ml of starting buffer followed by a 15-ml linear gradient of the same buffer containing 1 M NaCl and then a 10-ml wash with the 1 M NaCl buffer. The PKA was not adsorbed onto the DEAE column. The fractions containing PKA were pooled and concentrated to 5 ml using Centriplus concentrators (YM 10, Amicon, Bedford, MA).

Fractions from the DEAE-cellulose flow-through were loaded onto a 5-ml wheat germ agglutinin-agarose column equilibrated in 10 mM Tris-HCl, 50 mM NaCl, pH 7.4, containing 0.5 mM EGTA. After adsorption of the sample, the column was washed with 20 ml of starting buffer followed by a nonlinear gradient consisting of 15 ml of 50 mM Tris-HCl, 150 mM NaCl, pH 7.4, containing 0.5% Nonidet P-40, 0.1% SDS, and 5 mM EDTA. PKA was then eluted with 15 ml of 50 mM Tris-HCl, 500 mM NaCl, pH 7.4, containing 0.5% Trition-X100 and 0.5 mM EDTA. LAMPl, a lysosomal protein that co-purified with PKA through this point, was eluted from the wheat germ agglutinin column with 15 ml of 10 mM Tris-HCl, pH 8.0, containing 100 mM N-acetylglucosamine.

Fractions from the wheat germ agglutinin column with PKA activity were pooled, concentrated with Centriplus concentrators (YM 10, Amicon), and dialyzed against 10 mM Tris-HCl, 50 mM KCl, pH 7.4, containing 0.5 mM EGTA, after which they were loaded onto a 2-ml hydroxyapatite (calcium phosphate hydroxide) column equilibrated in the same buffer. Flow-through fractions containing PKA activity were pooled and concentrated to 3 ml using the Centriplus concentrators (YM 10, Amicon).

PKA from the hydroxyapatite chromatography or purified by the technique of Odya et al. (15) or Tan et al. (16) was applied to a 24-ml prepacked Superdex 200 HR 24/30 column (1.0 × 24 cm; Amersham Biosciences) equilibrated with 6 bed volumes of 50 mM sodium phosphate, 150 mM NaCl, pH 7.0, at 0.3 ml/min on an AKTA FPLC system (Amersham Biosciences). This column had been calibrated using the following molecular weight standards: bovine thyroid thyroglobulin, 669,000; horse spleen ferritin, 440,000; bovine liver catalase, 232,000; rabbit muscle aldolase, 158,000; bovine serum albumin, 67,000; hen egg ovalbumin, 43,000; bovine pancreas chymotrypsinogen A, 25,000; and bovine pancreas ribonuclease A, 13,700. Fractions of the gel filtration that contained PKA were pooled and concentrated in a Centricon-3 ultrafiltration device and frozen at -20 °C until assay.

Protein Sequencing-- Protein sequence analysis was performed at the Harvard Microchemistry Facility (Harvard University, Cambridge, MA). After tryptic digestions of protein eluted from bands of the SDS-PAGE, protein sequencing was performed by microcapillary reverse-phase HPLC nano-electrospray tandem mass spectrometry (µLC/MS/MS) on a Finnigan LCQ DECA quadrupole ion trap mass spectrometer (17-19).

Gel Electrophoresis and Immunoblot Studies-- Proteins in purification fractions were applied directly or were precipitated with 5% deoxycholate:trichloroacetic acid followed by solubilization in 15 µl of 2× SDS sample buffer containing 2% beta -mercaptoethanol and boiling for 5 min. The proteins were separated on an 8 or 12% SDS-PAGE. The SDS-PAGE was stained with Colloidal-Blue (Novex Technical Service, San Diego, CA) or silver (Bio-Rad). In certain experiments, proteins were separated on a 10% SDS-PAGE and then transferred to nitrocellulose membranes at 8 mA overnight. The membranes then were incubated in blocking buffer (5% (wt/v) dry milk with 0.1% (w/v) bovine serum albumin, 0.05% Tween 20, 0.15 M NaCl, and 20 mM Tris-HCl, pH 7.4) for 1 h (20). The nitrocellulose membranes were incubated with a rabbit antibody against PRCP (1:1,500; generously provided by Dr. Randal Skidgel, University of Illinois, Chicago) or a goat anti-PRCP peptide antisera (1:100) for 1 h at room temperature. After washing, the nitrocellulose was then incubated with an anti-rabbit or anti-goat antibody horseradish peroxidase conjugate, respectively. The specific reactivity of antibody with electroblotted sample was detected with the ECL system from Amersham Biosciences. In certain experiments, the immunoblot was scanned by densitometer (Model GS 300 Hoefer Scientific Instruments, San Francisco) in the transmittance mode to determine the band intensity and thus the relative amounts of protein present.

Laser Scanning Confocal Microscopy-- Monolayers of nonpermeabilized HUVEC grown on glass slides were washed and fixed in 2% paraformaldehyde for 15 min at 37 °C. After the slides were washed with 50 mM glycine in 0.01 M sodium phosphate, 0.15 M NaCl, pH 7.4 (phosphate-buffered saline), for 5 min at room temperature, the cells were incubated with rabbit antiserum to PRCP (1:100) or normal rabbit serum (1:100) in phosphate-buffered saline containing 1 mg/ml human gamma -globulin and 1 mg/ml glucose for 1 h at 37 °C. Rabbit antibody attached to the HUVEC was identified by incubating a goat anti-rabbit IgG conjugated with fluorescein isothiocyanate (1:50; Calbiochem) for 1 h at room temperature. After incubation, the cells were washed, covered with antifading mounting medium (Molecular probe, Eugene, OR), and analyzed on the laser scanning confocal microscopy as described previously (9).

Characterization of the PKA-- Initial experiments determined the inhibitory spectrum of isolated PKA. The ability of rabbit antisera or antibody to block PK activation by purified PRCP or endothelial cell-associated PKA was determined. The ability of purified PRCP to change the structure of PK bound to HK on plastic was determined in the absence or presence of 1 mM DFP, 3 mM PMSF, 300 µM angiotensin II, or 0.2 mg/ml neutralizing antibody to factor XIIa by immunoblot using an antibody to PK (Enzyme Research Laboratories) of the reaction mixture after reduced 10 or 12% SDS-PAGE (3, 8). Further studies determined the ability of 100 µM leupeptin or antipain, 1 mM o-phenanthroline and EDTA, 3 mM N- ethylmaleimide, or 5 mM iodoacetic acid or iodoacetamide to inhibit PKA activation of PK. Antipain, HgCl2, benzamidine, corn trypsin inhibitor, or Z-Pro-Pro-aldehyde-dimethyl acetate also were mixed in increasing concentrations with PKA in HCB for 1 min prior to the addition of PK to microtiter plate wells coated with HK. After 1 h of incubation at 37 °C, the wells were washed, and the formed kallikrein bound to HK was detected by hydrolysis of the 0.8 mM chromogenic substrate HD-Pro-Phe-Arg-pNA (S2302). Further investigations determined whether increasing concentrations of angiotensin II, angiotensin II-(1-7), bradykinin, bradykinin-(1-5) (peptide RPPGF), or Fmoc-Ala-Pyr-CN inhibited PK activation by the PKA. Fmoc-Ala-Pyr-CN is a prolyl oligopeptidase inhibitor (generously provided by Dr. Sherwin Wilk, Mount Sinai Medical School, New York) (21). The ability of the partially purified PKA to activate FXI and to clot factor XII-deficient plasma (George King, Overland Park, KS) was performed by an amidolytic assay using 0.8 mM L-pyroglutamyl-L-prolyl-L-arginine-pNA (S2366, Dia-Pharm, Franklin, OH) and by factor XII coagulant assay, respectively (20). PKA was also examined on immunoblot using antibody to factor XII. Finally, the ability of a neutralizing anti-FXII antibody (0.1-0.5 mg/ml) to block PK activation by purified PKA was determined. The ability of this antibody to inhibit the factor XII coagulant activity of 50% normal human plasma (181 nM factor XII) was determined in an activated partial thromboplastin time coagulant assay using reagents from Organon Teknika, Durham, NC.

Properties of the PKA-- The Km of PK activation by the PKA was determined by incubating increasing concentrations of PK with PKA at 37 °C. The kallikrein formed was detected by hydrolysis of 0.8 mM S2302. The optimal pH for PKA activity was also determined from a pH range of 5.5 to 10.5. MES was used to buffer the pH range from 5.5 to 6.8, HEPES was used from pH 7 to 7.4, Tris was used from pH 7.8 to 8.5, and Na2CO3 was used from pH 9 to 10.5. Activities did not vary more than 10% between buffers at the crossover pH values of 6.8 and 7.4. Additional studies determined the influence of Ca2+, Mg2+, Mn2+, and Zn2+ ions on PKA activity.

HK and PK Binding to HUVEC and PK Activation on HUVEC-- Biotinylated HK or PK binding to HUVEC in culture was performed as reported previously (3, 8). PK activation on endothelial cells also was performed as reported previously (3, 9). Additional studies determined whether angiotensin II, angiotensin II-(1-7), Fmoc-Ala-Pyr-CN, or Z-Pro-Pro-aldehyde-dimethyl acetate blocked PK activation when bound to HK on HUVEC (3).

Protein Assay-- Protein concentration was determined by the method of Bradford utilizing dye reagent from Bio-Rad and bovine serum albumin as a standard. Concentration of the purified PK activator also was determined by measuring UV absorption at 205 nm with the same bovine serum albumin as the standard and the eluting buffer as the blank.

    RESULTS
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Nature of HUVEC PK Activator (PKA)-- Previous investigations have indicated that the endothelial cell PK activator is inhibited by antipain, cysteine, HgCl2, dithiothreitol, or glutathione but not by 1 mM PMSF or benzamidine (3). Because PK activation on HK bound to endothelial cells required the binding of HK to HUVEC and the binding of PK to HK, any agent that interfered with these activities also would interfere with PK activation on endothelial cells. Initial investigations determined whether any of the above agents interfered with HK binding to HUVEC. In the presence of glutathione, cysteine, or dithiothreitol, HK binding to HUVEC was inhibited 50, 75, and 87%, respectively (data not shown). Alternatively, antipain and HgCl2 did not inhibit HK binding to HUVEC. HgCl2, however, was found to inhibit PK binding to HK on HUVEC by 25% (data not shown). Finally, experiments determined that 3 mM PMSF and 1 mM DFP, but not 1 mM PMSF as previously reported (3), prevented the conversion of PK to kallikrein on HUVEC as seen on reduced SDS-PAGE of solubilized cells with bound PK/kallikrein (data not shown). These combined data suggested that the hypothesized PK activator was a serine protease.

Development of the PKA Assay-- To isolate the PKA from endothelial cells, a specific assay was developed. The assembly of HK followed by PK and PKA in microtiter plate cuvette wells resulted in PK activation to kallikrein with hydrolysis of the chromogenic substrate, S2302 (Fig. 1). If PK was excluded from the mixture or HK was not linked to cuvette wells, no PK activation occurred. Similarly, exclusion of the PKA or the chromogenic substrate for kallikrein resulted in no detectable hydrolysis. If the complex between HK and PK is blocked by the addition of peptide SDD31, the PK binding site on HK, or a monoclonal antibody (HKL16) directed to the PK binding site on HK, PK activation also was prevented. These data indicated that PK must be bound to HK for activation by the PKA.


View larger version (10K):
[in this window]
[in a new window]
 
Fig. 1.   Prekallikrein activator assay. HK (1 µg/100 µl) was linked to a microtiter plate in 0.1 M Na2CO3, pH 9.6, overnight at 4 °C. After removing unbound HK, the cuvette wells were blocked with 1% gelatin for 1 h at 37 °C. In each reaction 20 nM PK in the presence of PKA in HCB was added to the wells in the absence (HK+PK+PKA) or the presence of 100 µM peptide SDD31 or 100 nM anti-HKL16 antibody. After 1 h of incubation at 37 °C, the wells were washed followed by the addition of 0.8 mM S2302. Hydrolysis of S2302 was monitored at 405 nm for 1 h at 37 °C. In certain experiments, wells were not linked with HK (PK+PKA), PK (HK+PKA), or PKA (HK+PK), or the chromogenic substrate was left out (HK+PK+PKA-S2302). The results are from a representative experiment of two showing kallikrein activity generated by PKA in the absence and presence of all of the controls at the same time.

Isolation of the PKA from Endothelial Cells-- HUVEC were homogenized and subjected to differential centrifugation to locate the fraction containing PKA using the above assay. The PKA activity was associated primarily with the 15,800 × g pellet, the fractions of HUVEC lysates enriched for granule or lysosomal material. Confirmation that PKA was from the granule-lysosomal compartment of HUVEC was indicated by the presence of lysosomal-associated membrane protein 1 (LAMP1) by immunoblot in the same fractions (data not shown).

A series of sequential column chromatography purification steps was performed to isolate the PKA. PKA and LAMP1 did not bind to DEAE-Sephadex. After the DEAE affinity chromatography, there was a large increase in the specific activity of the PKA with an apparent increase in yield suggesting that this isolation step eliminated an endogenous inhibitor of the enzyme (Table I). Wheat germ agglutinin bound both PKA and LAMP1; however, PKA eluted before LAMP1. Using size exclusion chromatography on hydroxyapatite, eluted PKA was purified 27,019-fold with 25% recovery of activity (Table I). The hydroxyapatite preparation of PKA on SDS-PAGE consisted of four bands at 96, 73, 48, and 24 kDa (data not shown). PKA activity was associated mostly with the 73- and 48-kDa bands (data not shown).

                              
View this table:
[in this window]
[in a new window]
 
Table I
Prekallikrein activator purification table

Amino acid sequencing of the four bands seen on SDS-PAGE using the microcapillary reverse-phase HPLC nano-electrospray tandem mass spectrometry technique resulted in the identification of 48 individual proteins. In the 73-kDa fraction, 12 distinct protein fragments were sequenced. One of the proteins identified by the amino acid sequencing was prolylcarboxypeptidase (lysosomal carboxylpeptidase, angiotensinase C), a serine protease of the renin-angiotensin system. PRCP is known to be present in endothelial cell lysosomes, but it is also present on endothelial cell membranes because it is a physiologic converting enzyme of angiotensin II to angiotensin II-(1-7) (22). To examine whether PRCP was a candidate PK activator, PRCP was purified from HUVEC by the technique of Odya et al. (15). Using the assay to detect PKA in the Odya purification schema (DEAE, CM-cellulose, SP-Sephadex, CM-cellulose, and hydroxyapatite chromatography), PKA was found in the identical fractions as PRCP. The data suggested that PKA and PRCP are in fact the same protein.

Characterization of PKA as PRCP-- Investigations were performed to determine whether PKA and PRCP co-eluted on FPLC (Fig. 2A). Final fractions of PKA from either the present purification schema or that of Odya et al. were applied to a Superdex 200 FPLC. A single peak of PKA was detected at fraction 32 (fractions 30-34, Fig. 2A). This location corresponded to a molecular weight on gel filtration of 62 ± 12 kDa (n = 23 separate fractionations). The fractions from the Superdex 200 FPLC were also immunoblotted with a rabbit antibody to PRCP (Fig. 2B) and a goat anti-PRCP peptide antiserum (Fig. 2C). PRCP antigen at 73 kDa was found in the identical fractions with fraction 32 containing the highest concentration of PRCP antigen (Fig. 2, A-C). Furthermore, increasing concentrations of rabbit antisera to PRCP blocked PKA activation of purified PK on HK in microtiter plates, whereas rabbit serum at the same dilution had little inhibitory effect (Fig. 3A). Likewise, increasing concentrations of purified rabbit IgG against PRCP blocked PK activation on HUVEC when the PK was bound to HK (Fig. 3B). These combined data suggested that PKA and PRCP antigen were the same proteins.


View larger version (23K):
[in this window]
[in a new window]
 
Fig. 2.   Characterization of PKA on FPLC. A, the kallikrein activity formed as a result of the presence of PKA () was plotted versus the FPLC fraction number. Also, the intensity of PRCP antigen as detected by immunoblot (black-square) was plotted against the FPLC fraction number. The peak fraction for both PKA activity and immunoblot identification of PRCP was fraction 32. PKA activity was measured by its ability to activate PK bound to HK in microtiter plates (see "Experimental Procedures"). The results shown are from one representative experiment of five. The immunochemical reactivity of these fractions to anti-PRCP was determined by immunoblot, quantified by densitometer, and expressed as an arbitrary unit of density. B, Western blot of fraction 32 using rabbit anti-PRCP. The immunoblot detects a 73-kDa protein. C, Western blot of Fraction 32 using goat anti-PRCP peptide. This immunoblot also detects a 73-kDa protein.


View larger version (13K):
[in this window]
[in a new window]
 
Fig. 3.   Anti-PRCP antibody inhibits PK activation. A, microtiter plate cuvette wells coupled with 20 nM HK were incubated for 1 h at 37 °C with 20 nM PK and PKA in HCB in the absence or presence of increasing concentrations of rabbit anti-PRCP antiserum () or preimmune rabbit serum (black-square). B, monolayers of HUVEC were incubated with 20 nM HK followed by 20 nM PK in the absence or presence of increasing concentrations of purified rabbit anti-PRCP () or preimmune IgG (black-square). At the end of the incubation, the wells were washed and the percent inhibition of PK activation was determined by the amount of residual kallikrein hydrolysis of 0.8 mM S2302 compared with an uninhibited sample. The results shown are a representative experiment of two.

Studies were done to determine the inhibitory profile of isolated PKA. Because serine protease inhibitors block both PKA activation of PK and kallikrein activity formed, our investigations determined whether DFP or PMSF blocked the formation of kallikrein by PKA, as detected by reduced SDS-PAGE followed by immunoblot (Fig. 4A). Under the conditions of the assay, PKA-treated PK resulted in 15% kallikrein formation as indicated by the presence of a 50-kDa heavy chain and two light chains at 42 and 38 kDa on this gel electrophoresis system (Fig. 4A). In the presence of 1 mM DFP or 3 mM PMSF, kallikrein did not form. These data suggested that the PKA was a serine protease. Further studies were performed against other inhibitors. Leupeptin and antipain both at 100 µM neutralized the kallikrein-forming activity of PKA (Fig. 4B). One mM EDTA or o-phenanthroline inhibited about 2 or 12% of PKA activity, respectively (Fig. 4B). Three mM N-ethylmaleimide reduced PKA activity by 30%. However, 5 mM iodoacetic acid or iodoacetamide had no inhibitory activity on PKA. These combined studies indicated that PKA was a serine protease.


View larger version (13K):
[in this window]
[in a new window]
 
Fig. 4.   Characterization of isolated PKA. A, The ability of serine protease inhibitors to block PK activation by PKA. Purified PK (20 nM) was incubated in microtiter plates cuvette wells pre-coated with 20 nM HK in the absence or presence of 1 mM DFP or 3 mM PMSF. After incubation, the wells were solubilized with sample buffer for SDS-PAGE, reduced with 2% beta -mercaptoethanol and boiled, and electrophoresed on a 10% SDS-PAGE. The electrophoresed proteins were then transferred onto nitrocellulose followed by immunoblot with a polyclonal antibody to human PK. The numbers to the left of the gel represent molecular mass standards in kilodaltons. B, the influence of various inhibitors on PKA activation of PK. The ability of PKA to activate PK bound to HK in the absence or presence of 100 µM leupeptin or antipain, 1 mM o-phenanthroline or EDTA, 3 mM N-ethylmaleimide, or 5 mM iodoacetamide or iodoacetic acid was measured. At the end of the incubation, the wells were washed and the amount of kallikrein activity determined by hydrolysis of 0.8 mM S2302 was compared with an uninhibited sample. The results shown are the mean ± S.E. of three experiments.

Next investigations were performed to determine whether the inhibitory profile of PKA was consistent with that of PRCP. As reported previously, antipain inhibited PKA with an IC50 of 2 µM, but benzamidine had no effect at 10 mM (3) (Fig. 5). HgCl2 inhibited PRCP with an IC50 of 500 µM. The prolyl oligopeptidase inhibitor Z-Pro-Pro-aldehyde-dimethyl acetate inhibited PKA with an IC50 of 1 µM (Fig. 5). The serine protease inhibitor corn trypsin inhibitor also was an inhibitor of PKA with an IC50 of 40 nM (Fig. 5). This latter result suggested that PKA might be contaminated with trace amounts of factor XIIa. However, purified PKA did not correct the coagulant defect of factor XII-deficient plasma and did not hydrolyze the factor XIIa substrate, H-D-Pro-Phe-Arg-pNA. Further, PKA was isolated from endothelial cells grown in 2% human factor XII-deficient serum. Antibody to human factor XII did not recognize purified PKA from HUVEC on immunoblot. A neutralizing antibody to factor XII, which at 0.1-0.5 mg/ml concentrations completely inhibited the coagulant activity of 50% normal human plasma, had no specific inhibitory activity against PKA. Finally, isolated PKA was unable to activate factor XI bound to HK on a microtiter plate. These data and the fact that PKA is not inhibited by benzamidine indicated that PKA is not factor XIIa nor is PRCP contaminated with catalytic amounts of factor XIIa.


View larger version (20K):
[in this window]
[in a new window]
 
Fig. 5.   Specific inhibitors of PKA. Microtiter plate cuvette wells were coupled with HK. After blocking with 1% gelatin, 20 nM PK and PKA were incubated in the wells in the absence or presence of increasing concentration of antipain (), benzamidine (black-square), Z-Pro-Pro-aldehyde-dimethyl acetate (Z-Pro-Pro) (black-triangle), corn trypsin inhibitor (CTI), (black-down-triangle ), or HgCl2 (black-diamond ). The amount of kallikrein activity formed in the presence of each of these inhibitors was determined by hydrolysis of 0.8 mM S2302 and compared with an uninhibited control. The results are the mean data using PK activator from three separate purifications and are expressed as % prekallikrein activation.

Further evidence that the isolated PKA was PRCP was determined by substrate inhibition studies (Fig. 6). Two µM angiotensin II, the preferred known substrate of PRCP, inhibited isolated PKA by 50% (Fig. 6). Alternatively, angiotensin II-(1-7), which does not have the carboxyl-terminal phenylalanine of angiotensin II, did not inhibit PKA at 150 µM. Similarly, bradykinin, another substrate of PRCP, but not bradykinin-(1-5), inhibited PKA with an IC50 of 100 µM (Fig. 6) (23). Finally, the prolyl oligopeptidase inhibitor Fmoc-Ala-Pyr-CN inhibited the PKA with an IC50 of 50 nM (Fig. 6). These combined data also indicated that PKA was PRCP.


View larger version (21K):
[in this window]
[in a new window]
 
Fig. 6.   Substrate inhibition of PKA. Microtiter plate cuvette wells were coupled with HK and incubated with 20 nM PK and PKA in the absence or presence of increasing concentrations of angiotensin II (), angiotensin II-(1-7) (black-square), bradykinin (BK) (black-triangle), bradykinin-(1-5) (black-down-triangle ), or Fmoc-Ala-Pyr-CN (black-diamond ). The degree of PK activation in the presence of PKA and the various substrates of PRCP was compared with the amount of kallikrein formed in the absence of these substrates. The results, which are the mean data using PKA from three separate purifications, are expressed as % prekallikrein activation.

Investigations were performed to determine which of the known substrates and inhibitors of PRCP would inhibit PK activation when assembled on HK on cultured endothelial cells (Fig. 7). Angiotensin II at 100 µM, but not angiotensin II-(1-7), blocked PK activation on HUVEC with 100% inhibition at 100 µM (Fig. 7). Fmoc-Ala-Pyr-CN and Z-Pro-Pro-aldehyde-dimethyl acetate also completed inhibited PK activation on HUVEC 100% at 3 and 10 mM concentration, respectively.


View larger version (10K):
[in this window]
[in a new window]
 
Fig. 7.   The ability of PRCP inhibitors to block PK activation on HUVEC. Purified PK (20 nM) and HK (20 nM) in HCB were incubated with HUVEC monolayers in microtiter plate wells in the absence or presence of 100 µM angiotensin II, 100 µM angiotensin II-(1-7), 3 mM Fmoc-Ala-Pyr-CN, or 10 mM Z-Pro-Pro-aldehyde-dimethyl acetate (Z-Pro-Pro) for 1 h at 37 °C. At the end of the incubation, the cells were washed with HCB, 0.8 mM S2302 was added, and the hydrolysis of the substrate was monitored for 1 h. The results presented are the mean ± S.E. of three separate experiments.

Properties of PKA (PRCP)-- The Km of PRCP for PK is 6.7 nM (Fig. 8). The PKA was stable at 37 °C with a half-life of 240 min. At 95 °C, all activity was lost after 3 min of incubation. The PKA-induced activation of PK exhibited a high level of activity (>75% of maximum) between pH 6.8 and 7.4, with an optimum at pH 7.1. PKA activity was optimal with 10 µM CaCl2 and 1 mM MgCl2, but various concentrations of BaCl2, NiCl2, CdCl2, CuCl2, and MnCl2 had little influence on PKA activity. Finally, investigations were performed to determine the structure of PRCP-formed versus factor XIIa-formed plasma kallikrein (Fig. 9). Both PRCP and factor XIIa produced a 50-kDa heavy chain and 39- and 36-kDa light chains of reduced plasma kallikrein (Fig. 9A). However, angiotensin II at 300 µM blocked PRCP cleavage and activation of PK but not the cleavage and activation produced by factor XIIa (Fig. 9, A and B). Alternatively, neutralizing antibody to factor XIIa blocked factor XIIa cleavage and activation of PK but did not inhibit PRCP cleavage and activation (Fig. 9, A and B). Under the conditions of the assay shown in Fig. 9B, 40 pM of factor XIIa alone was insufficient to hydrolyze the chromogenic substrate itself (data not shown). These data suggested that PRCP and factor XIIa were distinctly different kallikrein-forming enzymes.


View larger version (18K):
[in this window]
[in a new window]
 
Fig. 8.   The Km of PKA (PRCP) for prekallikrein. The Km of PRCP activation of PK (black-square) was determined by incubating PRCP for 1 h at 37 °C in the presence of increasing concentrations of PK (2.5 to 100 nM) in microtiter plates coupled with HK. In other experiments, increasing concentrations of PK alone were incubated in microtiter plates coupled with HK in the absence of PRCP (). The amount of kallikrein activity formed was determined by incubating each well with 0.8 mM S2302. In the inset, a double reciprocal plot of the kinetic data is fitted to a straight line. The estimated apparent Km with respect to prekallikrein was 6.7 nM, and the apparent Vmax was 4.5 fmol/min.


View larger version (36K):
[in this window]
[in a new window]
 
Fig. 9.   The structure and activity of PRCP-formed kallikrein. Two µg of HK was linked overnight to microtiter plate wells. After being washed, all wells were incubated for 1 h at 37 °C with 20 nM PK in the absence or presence of PRCP (PKA) or FXIIa (40 pM) in the absence or presence of 300 µM angiotensin II (AgII) or 0.2 mg/ml neutralizing antibody to factor XIIa (Ab). In panel A, at the completion of incubation, the reactions were stopped by the addition of sample buffer for SDS-PAGE, and the solubilized reactions were reduced with 2% beta -mercaptoethanol, boiled, and applied to a 12% SDS-PAGE for electrophoresis. The samples were then transferred by electroblot onto nitrocellulose followed by immunoblot with a polyclonal antibody to human prekallikrein. The formed kallikrein was detected by a second antibody conjugated with horseradish peroxidase followed by chemiluminescence and autoradiography. The numbers to the right of the gel represents molecular mass standards in kilodaltons. In panel B, additional wells with the same conditions as in A were prepared at the same time, and after washing, 0.8 mM S2302 was added, and hydrolysis proceeded for 1 h at 37 °C. The data presented are the means of triplicate wells of a representative experiment.

PRCP Is Expressed on HUVEC-- Investigations were performed to determine the expression of PRCP on fixed but nonpermeabilized HUVEC in culture (Fig. 10). On laser scanning confocal microscopy, PRCP antigen is expressed on nonpermeabilized HUVEC membranes (Fig. 10). These data indicated that a portion of the lysosomal carboxylpeptides is constitutively expressed on the membrane of cultured endothelial cells.


View larger version (22K):
[in this window]
[in a new window]
 
Fig. 10.   Laser scanning confocal microscopy of HUVEC PRCP. Paraformaldehyde-fixed but not permeabilized resting HUVEC grown on glass slides were incubated with rabbit anti-human PRCP antibody (lower panel) or with preimmune rabbit serum (upper panel) at 1:100 dilution. The binding of the rabbit anti-PRCP or normal rabbit antibody was detected with a secondary goat anti-rabbit IgG labeled with fluorescein isothiocyanate. The figure, which is a laser scanning confocal micrograph, is representative of two experiments.


    DISCUSSION
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

Several novel observations have emerged from these studies. PK activation on HUVEC is initiated by a membrane-associated enzyme called prekallikrein activator. This enzyme is the first identified cell-associated activator of the plasma kallikrein/kinin system, better known as the "contact system." These studies also provide evidence that the HUVEC PKA is PRCP. The evidence that PKA is PRCP is that they overlap on gel filtration, the antibody to PRCP inhibits PKA and PK activation on HUVEC, and substrates of PRCP block PK activation by partially purified endothelial cell PKA and on endothelial cells themselves. PRCP is a ubiquitous enzyme that cleaves carboxyl terminally to proline, for which the known substrates are angiotensin I and angiotensin II, converting both to angiotensin II-(1-7) (15, 16, 23). As a converting enzyme for angiotensins, PRCP changes the blood pressure-elevating and prothrombotic effects of angiotensin II to a vasodilatory peptide, angiotensin II-(1-7), that directly stimulates NO and prostacyclin formation (24-26). Recognition that PRCP also activates PK is the first evidence to our knowledge that this enzyme is an endoproteinase. It also indicates that this enzyme indirectly produces bradykinin, which potentiates the vasodilatory effects of angiotensin II-(1-7) (27). These data suggest that the regulation of expression of PRCP is important in maintaining vasodilatory activity in the intravascular compartment. Recognition that PRCP of the renin-angiotensin system is a plasma prekallikrein activator indicates a new and potentially important interaction between these two systems.

It was an initial concern that the PKA was found to be inhibited by corn trypsin inhibitor. Corn trypsin inhibitor is only known as an inhibitor to factor XIIa. Although unpublished studies from our laboratory show that corn trypsin inhibitor also inhibits urokinase and tissue plasminogen activator, no other enzymes have been described as sensitive to corn trypsin inhibitor. However, the partially isolated PRCP did not hydrolyze a factor XIIa substrate or correct the coagulant defect of factor XII-deficient plasma, was present when purified from endothelial cells that were cultured in human factor XII deficient serum, was not recognized by antibody to human factor XII, was not inhibited by a neutralizing antibody to factor XII, and did not activate factor XI. Finally, factor XII binds to the DEAE column under the conditions used in the purification of PKA, whereas PRCP does not (15, 28). These combined data indicated that PKA is not factor XIIa and that factor XIIa in catalytic amounts is not present in the PRCP preparation.

PK activation when bound to HK occurs by the presence of a membrane-associated enzyme. It seems a paradox to identify the PKA as PRCP, lysosomal carboxylpeptidase, i.e. an enzyme purified from the lysosomal fraction of endothelial cells. However, PRCP itself is known to be present on membranes of cells because it is the physiologic converter of plasma angiotensin II to angiotensin II-(1-7) (22, 29). On laser scanning confocal microscopy PRCP is constitutively expressed on the external membrane of cultured endothelial cells. These data indicate that a portion of the lysosomal pool of PRCP is expressed upon the cell membrane (30). Recent cell biology studies suggest that the lysosomal compartment in all eukaryotic cells is an endomembrane system that is intimately involved in the export of internal constituents (31).

The properties of PRCP are not fully known. On gel filtration, the PK activation activity and antigen appear as a 62 ± 12-kDa protein consistent with its predicted molecular mass of 55.8 kDa of the full-length, unprocessed precursor. This molecular size is similar to its migratory features on reduced SDS-PAGE where it is a 73-kDa protein. This latter molecular size is similar to the SDS-PAGE migration of PRCP isolated from human kidney.2 The inhibition of PRCP by Fmoc-Ala-Pyr-CN or Z-Pro-Pro-aldehyde-dimethyl acetate, two prolyl oligopeptidase inhibitors, provides evidence for its varied features. However, the relatively flat slope of inhibition produced by Fmoc-Ala-Pyr-CN probably reflects the fact that this inhibitor was developed against prolyl oligopeptidases and not prolylcarboxypeptidase (21). How PRCP cleaves PK to activate it to kallikrein is not completely known. The factor XIIa catalytic site on PK is Arg371-Ile372. The structure of kallikrein generated by PRCP on reduced SDS-PAGE is similar to that produced by factor XIIa-activated PK (3). These data suggest that the PRCP may be cleaving PK at the same Arg371-Ile372 site as factor XIIa. It is of interest that prorenin is activated by cleavage to an aspartyl protease at more than one site (32). Further investigations are needed to determine the exact site of PRCP activation of PK. Finally, previous studies have shown that the physiologic substrates of PRCP are angiotensin II (Km = 0.2 mM) and bradykinin (Km = 1 mM) (15, 16). The finding that the Km of PRCP for PK is 6.7 nM indicates that PK also is an important substrate for this enzyme.

The recognition that PRCP is both a PK activator and an angiotensin II inactivator indicates another previously unappreciated interaction between the plasma kallikrein/kinin and the renin-angiotensin systems. Recent data suggest the renin-angiotensin system along with its ability to elevate blood pressure is independently prothrombotic by the ability of angiotensin II to stimulate plasminogen activator inhibitor 1 release (24, 33). Alternatively, the plasma kallikrein/kinin system through its ability to generate bradykinin, which stimulates tissue plasminogen activator liberation, prostacyclin formation, and NO synthesis, and kininogen, which interferes with thrombin activity, has been proposed to be profibrinolytic and anticoagulant (34-37). This interpretation suggests that the physiologic role of the plasma kallikrein/kinin system is as a counterbalance to the renin-angiotensin system. Recognition that PRCP is both an activator of PK as well as an inactivator of angiotensin II supports this notion.

    ACKNOWLEDGEMENTS

We thank Dr. Sherwin Wilk, Mount Sinai School of Medicine, New York, for providing the prolyl oligopeptidase inhibitor, Fmoc-Ala-Pyr-CN. We also extend our thanks to Drs. Randal Skidgel, F. Tan, P. Deddish, and Ervin Erdös of the University of Illinois, Chicago, for very generously providing the polyclonal rabbit anti-human-PRCP antibody and to Dr. Lilli Petruzzelli for her advice and encouragement.

    FOOTNOTES

* This work was supported by National Institutes of Health Grant HL52779.The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

To whom correspondence should be addressed: Dept. of Internal Medicine, University of Michigan, 5301 MSRB III, 1150 W. Medical Center Dr., Ann Arbor, MI 48109-0649. Tel.: 734-647-3124; Fax: 734-647-5669; E-mail: aschmaie@umich.edu.

Published, JBC Papers in Press, February 5, 2002, DOI 10.1074/jbc.M106101200

2 R. Skidgel, personal communication.

    ABBREVIATIONS

The abbreviations used are: PK, prekallikrein; HK, high molecular weight kininogen; FX, factor X; PKA, endothelial cell prekallikrein activator; PRCP, prolylcarboxypeptidase; HUVEC, human umbilical vein endothelial cells; HCB, HEPES-carbonate buffer; LAMP1, lysosomal-associated membrane protein 1; HPLC, high pressure liquid chromatography; PMSF, phenylmethylsulfonyl fluoride; DFP, diisopropyl fluorophosphate; pNA, p-nitroanilide; MES, 4-morpholineethanesulfonic acid; FPLC, fast protein liquid chromatography; Fmoc, N-(9-fluorenyl)methoxycarbonyl.

    REFERENCES
TOP
ABSTRACT
INTRODUCTION
EXPERIMENTAL PROCEDURES
RESULTS
DISCUSSION
REFERENCES

1. Motta, G., Hasan, A. A. K., Cines, D. B., and Schmaier, A. H. (1995) Blood 86 Suppl. 1, 374a
2. Lin, Y., Harris, R. B., Yan, W., McCrae, K. R., Zhang, H., and Colman, R. W. (1997) Blood 90, 690-697[Abstract/Free Full Text]
3. Motta, G., Rojkjaer, R., Hasan, A. A. K., Cines, D. B., and Schmaier, A. H. (1998) Blood 91, 516-528[Abstract/Free Full Text]
4. Herwald, H., Dedio, J., Kellner, R., Loos, M., and Muller-Esterl, W. (1996) J. Biol. Chem. 271, 13040-13047[Abstract/Free Full Text]
5. Joseph, K., Ghebrehiwet, B., Peerschke, E. I. B., Reid, K. B. M., and Kaplan, A. P. (1996) Proc. Natl. Acad. Sci. U. S. A. 93, 8552-8557[Abstract/Free Full Text]
6. Colman, R. W., Pixley, R. A., Najamunnisa, S., Yan, W.-Y., Wang, J., Mazar, A., and McCrae, K. R. (1997) J. Clin. Invest. 100, 1481-1487[Medline] [Order article via Infotrieve]
7. Hasan, A. A. K., Zisman, T., and Schmaier, A. H. (1998) Proc. Natl. Acad. Sci. U. S. A. 95, 3615-3620[Abstract/Free Full Text]
8. Shariat-Madar, Z., Mahdi, F., and Schmaier, A. H. (1999) J. Biol. Chem. 274, 7137-7145[Abstract/Free Full Text]
9. Mahdi, F., Shariat-Madar, Z., Todd, R. F., III, Figueroa, C. D., and Schmaier, A. H. (2001) Blood 97, 2342-2350[Abstract/Free Full Text]
10. Colman, R. W., and Schmaier, A. H. (1997) Blood 90, 3819-3843[Free Full Text]
11. Berretini, M., Schleef, R. R., Heeb, M. J., Hopmeier, P., and Griffin, J. H. (1992) J. Biol. Chem. 267, 19833-19839[Abstract/Free Full Text]
12. Shariat-Madar, Z., Mahdi, F., and Schmaier, A. H. (2001) Thromb. Haemostasis 85, 544-551[Medline] [Order article via Infotrieve]
13. Rojkjaer, R., and Schmaier, A. H. (1999) Proc. Assoc. Am. Physicians 111, 220-227[CrossRef][Medline] [Order article via Infotrieve]
14. Rojkjaer, R., Hasan, A. A. K., Motta, G., Schousboe, I., and Schmaier, A. H. (1998) Thromb. Haemostasis 80, 74-81[Medline] [Order article via Infotrieve]
15. Odya, C. E., Marinkovic, D. V., Hammon, K. J., Stewart, T. A., and Erdos, E. G. (1978) J. Biol. Chem. 253, 5927-5931[Abstract/Free Full Text]
16. Tan, F., Morris, P. W., Skidgel, R. A., and Erdos, E. G. (1993) J. Biol. Chem. 268, 16631-16638[Abstract/Free Full Text]
17. Eng, J. K., McCormick, A. L., and Yates, J. R., III (1994) J. Am. Soc. Mass. Spectrom. 5, 976-989[CrossRef]
18. Chittum, H. S., Lane, W. S., Carlson, B. A., Roller, P. P., Lung, F. T., Lee, B. J., and Hatfield, D. L. (1998) Biochemistry 37, 10866-10870[CrossRef][Medline] [Order article via Infotrieve]
19. LeRoy, G., Orphanides, G., Lane, W. S., and Reinberg, D. (1998) Science 282, 1900-1904[Abstract/Free Full Text]
20. Schmaier, A. H., Farber, A. H., Schein, R., and Sprung, C. (1988) J. Lab. Clin. Med. 112, 182-192[Medline] [Order article via Infotrieve]
21. Li, J., Wilk, E., and Wilk, S. (1996) J Neurochem. 66, 2105-2112[Medline] [Order article via Infotrieve]
22. Ferrario, C. M., and Iyer, S. N. (1998) Regul. Pept. 78, 13-18[CrossRef][Medline] [Order article via Infotrieve]
23. Yang, H. Y. T., Erdos, E. G., and Chiang, T. S. (1967) Nature 218, 1224-1226
24. Brown, N. J., and Vaughan, D. E. (2000) Adv. Intern. Med. 45, 419-429[Medline] [Order article via Infotrieve]
25. Oliveira, M. A., Fortes, Z. B., Santos, R. A. S., Kosla, M. C., and De Carvalho, M. H. C. (1999) Peptides 20, 1195-1201[CrossRef][Medline] [Order article via Infotrieve]
26. Feterik, K., Smith, L., and Katusic, Z. S. (2000) Brain Res. 873, 75-82[CrossRef][Medline] [Order article via Infotrieve]
27. Ping, L., Chapppell, M. C., Ferrario, C. M., and Brosnihan, K. B. (1997) Hypertension 29, 394-400[Abstract/Free Full Text]
28. Fujikawa, K., and Davie, E. W. (1981) Methods Enzymol. 80, 198-211
29. Santos, R. A. S., Brosnihan, K. B., Jacobsen, D. W., DiCorleto, P. E., and Ferrario, C. M. (1992) Hypertension 19, Suppl II, II-56-II-61
30. Skidgel, R. A., and Erdos, E. G. (1998) Immunol. Rev. 161, 129-141[CrossRef][Medline] [Order article via Infotrieve]
31. Biederbick, A., Rose, S., and Elsasser, H.-P. (1997) J. Cell Sci. 112, 2473-2484[Abstract]
32. Reudelhuber, T. L., Brechler, V., Jutras, I., Mercure, C., and Methot, D. (1998) Adv. Exp. Med. Biol. 436, 229-238[Medline] [Order article via Infotrieve]
33. Vaughan, D. E., Lazos, S. A., and Tong, K. (1995) J. Clin. Invest. 95, 995-1001[Medline] [Order article via Infotrieve]
34. Brown, N. J., Gainer, J. V., Stein, C. M., and Vaughan, D. E. (1999) Hypertension 33, 1431-1435[Abstract/Free Full Text]
35. Hong, S. L. (1980) Thromb. Res. 18, 787-795[CrossRef][Medline] [Order article via Infotrieve]
36. Palmer, R. M. J., Ferrige, A. G., and Moncada, S. (1987) Nature 372, 524-526
37. Meloni, F. J., and Schmaier, A. H. (1991) J. Biol. Chem. 266, 6786-6794[Abstract/Free Full Text]


Copyright © 2002 by The American Society for Biochemistry and Molecular Biology, Inc.
Add to CiteULike CiteULike   Add to Complore Complore   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us   Add to Digg Digg   Add to Reddit Reddit   Add to Technorati Technorati    What's this?


This article has been cited by other articles:


Home page
BloodHome page
Z. Shariat-Madar, F. Mahdi, M. Warnock, J. W. Homeister, S. Srikanth, Y. Krijanovski, L. J. Murphey, A. A. Jaffa, and A. H. Schmaier
Bradykinin B2 receptor knockout mice are protected from thrombosis by increased nitric oxide and prostacyclin
Blood, July 1, 2006; 108(1): 192 - 199.
[Abstract]</