Originally published In Press as doi:10.1074/jbc.M207847200 on September 12, 2002
J. Biol. Chem., Vol. 277, Issue 49, 46923-46931, December 6, 2002
Alphavirus 6K Proteins Form Ion Channels*
Julian V.
Melton
,
Gary D.
Ewart§,
Ronald C.
Weir¶,
Philip
G.
Board
,
Eva
Lee
, and
Peter W.
Gage
**
From the
Division of Molecular Bioscience, John
Curtin School of Medical Research, The Australian National University,
GPO Box 334, Canberra ACT 2601, Australia, § Biotron
Limited, LPO Box A315, Australian National University, Canberra
ACT 2601, Australia, the ¶ School of Biochemistry and Molecular
Biology, The Australian National University, GPO Box 334, Canberra ACT
2601, Australia, and the
Division of Immunology and Genetics,
John Curtin School of Medical Research, The Australian National
University, GPO Box 334, Canberra ACT 2601, Australia
Received for publication, August 2, 2002
 |
ABSTRACT |
Ross River virus and Barmah Forest virus are
Australian arboviruses of the Alphavirus genus. Features of
alphavirus infection include an increased permeability of cells to
monovalent cations followed by virion budding. Virally encoded ion
channels are thought to have a role in these processes. In this paper,
the 6K proteins of Ross River virus and Barmah Forest virus are shown
to form cation-selective ion channels in planar lipid bilayers. Using a
novel purification method, bacterially expressed 6K proteins were
inserted into bilayers with a defined orientation (i.e.
N-terminal cis, C-terminal trans). Channel
activity was reversibly inhibited by antibodies to the N and C termini
of 6K protein added to the cis and trans baths,
respectively. Channel conductances varied from 40-800
picosiemens, suggesting that the protein is able to form
channels with a range of possible oligomerization states.
 |
INTRODUCTION |
Members of the Alphavirus genus include a number of
medically significant pathogens: Western, Eastern, and Venezuelan
equine encephalitis viruses, Chikungunya virus, O'nyong-nyong fever
virus, Sindbis and Semliki Forest viruses (SFV) (on which most of the extensive molecular characterization of alphaviruses is based), Ross
River virus (RRV),1 and
Barmah Forest virus (BFV). The latter two viruses are the etiological
agents of epidemic polyarthritis in Australia.
Alphaviruses have an approx. 11.7 kb single-stranded RNA genome of
positive sense. The 5' end (7.6 kb) encodes components involved in
genomic replication and mRNA synthesis. The 3' end (4.1 kb) encodes
the structural proteins of the virus. The structural proteins are
translated from a subgenomic mRNA as a single polyprotein in the
order capsid-PE2-6K-E1. The polyprotein is cotranslationally translocated across the ER membrane. Signal sequences alternating with
stop-transfer (anchor) sequences direct the topology of the polyprotein
with respect to the ER membrane (1). Cleavage occurs via cellular
proteases and the autoprotease activity of the capsid protein to
generate the viral capsid and membrane proteins (2).
Alphavirus 6K proteins are small (58-61 amino acids), hydrophobic, and
associate with membranes (3). The function of 6K protein in the virus
life cycle is not fully understood. However, the 6K protein of SFV has
been shown to function as a stop-transfer peptide sequence for the
insertion of the E1 protein into the ER membrane (1). Additionally,
expression of 6K protein causes an increase in membrane permeability in
Escherichia coli and enhances both membrane permeability and
viral budding in eukaryotic cells (4-8.) On the basis of these
observations and structural similarity with other small virus proteins,
it has been suggested that the 6K protein is a virally encoded ion
channel (viroporin) (9). Viroporins are short (50-120 amino acids),
integral membrane proteins that enhance membrane permeability in
infected cells (9). Viroporins have been shown to affect glycoprotein
processing, transport of proteins through the ER, and virion budding
(6, 10-13). Other proteins identified as viroporins include the M2
protein of influenza A (14, 15), the NB protein of influenza B (16),
the Vpu and Vpr proteins of HIV-1 (17, 18), and the 3A and 2B proteins of poliovirus (19, 20). The members with confirmed ion channel activity
are: M2, NB, Vpr, and Vpu (15-18, 21). Of these four proteins, M2 is
the only one for which the role of the ion channel activity in the
physiological functions of the protein is understood (22).
The topology of the structural proteins of SFV has been determined by
in vitro translation-translocation assay (1). The results
obtained were consistent with the 6K protein crossing the membrane
twice (1). However, prediction of transmembrane regions by the method
of Sonnhammer et al. (23) suggests that all mature
alphavirus 6K proteins cross the membrane only once (see Fig.
1B) (23). In this paper, we present evidence that the 6K
protein spans the membrane once when reconstituted in vesicles or
incorporated into planar lipid bilayers.
We show that purified, recombinant 6K proteins from both BFV and RRV
form cation-selective ion channels when inserted into planar lipid
bilayers. Antibodies specific for each 6K species were found to inhibit
channel activity. Additionally, the site-directed mutation of serine 32 to proline (S32P) in BFV 6K protein resulted in altered ionic
selectivity of the channel. A synthetic peptide, corresponding to the
amino acid sequence of BFV 6K protein (B6Kpep), also makes ion
channels with similar properties.
 |
EXPERIMENTAL PROCEDURES |
Cloning of RRV 6K and BFV 6K--
The coding sequence for the
BFV 6K gene was amplified from a BFV cDNA clone (24), which
contained the 6K gene region using the primers 98-16
(5'-cgcgggatccgacactttagatgat), which introduces a
BamHI site (underlined) and 98-17
(5'-attactcgagtcaggcctgcgtggcaa), which introduces a
XhoI site (underlined). The coding sequence for
the RRV 6K gene was amplified from a cDNA genomic clone of RRV
strain T48 (25). Primers used were 98-14
(5'-cgagggatccgcatcattcgctgag), which introduces a
BamHI site (underlined) and 98-55
(5'-gccgctcgagtcaagcttttgcggagg), which introduces a
XhoI a site (underlined). PCR was performed with
0.035 units/µl native Pfu polymerase (Stratagene) in a
Corbett Research FTS-1 capillary thermocycler with the following
parameters: one cycle of 94 °C for 2 min; 25 cycles of 94 °C for
30 s, 45 °C for 1 min, 72 °C for 30 s; and one cycle of
72 °C for 5 min. PCR product size was confirmed by electrophoresis
on 2% TAE (40 mM Tris acetate, 1 mM
EDTA)-agarose gels (6 V/cm, 1 h) followed by ethidium bromide
staining (50 µg/ml) and photography (26). PCR products were
gel-purified (QIAquick gel extraction kit; Qiagen), digested with
restriction enzymes (BamHI followed by XhoI), and ligated into the vector p2GEX (21), which had also been
BamHI/XhoI-digested and 5'-dephosphorylated with
shrimp alkaline phosphatase.
The plasmid p2GEX is based on pGEX-2T (Amersham Biosciences),
and contains an additional copy of the Schistosoma japonicum GST cDNA designed to express an unfused copy of GST. Previous observations from this laboratory suggest that the co-expression of
free (unconjugated) GST in addition to the GST fusion from the same
plasmid can enhance cytoplasmic yields of largely insoluble GST fusion
proteins (17, 21). E. coli strain XL1 Blue (Stratagene) was used as a transformation host for subsequent plasmid maintenance and site-directed mutagenesis (26).
Site-directed Mutagenesis--
To create a mutation from serine
to proline at position 32 of BFV 6K (named BFV 6K S32P) recombinant PCR
was used (26). The two primary amplifications were carried out with
primers 98-16/98-18 and 98-19/98-17, respectively (98-19 = 5'-gtgcttaccctattgct; 98-18 = 5'-agcaatagggtaagcac). Thermocyling
parameters were: one cycle of 94 °C for 3 min; five cycles of
94 °C for 30 s, 45 °C for 1 min, 72 °C for 30 s, 25 cycles of 94 °C for 30 s, 45 °C for 1 min, and 72 °C for
30 s. Primary PCR products were gel-purified as described above,
and 10 ng of each used as template in the secondary reaction
(parameters used were: one cycle of 94 °C for 3 min, five cycles of
94 °C for 30 s, 37 °C for 1 min, 72 °C for 30 s, 25 cycles of 94 °C for 30 s, 45 °C for 1 min, and 72 °C for
30 s. The secondary PCR product was digested with
BamHI/XhoI, ligated into p2GEX, and transformed
into E. coli XLI Blue as described above. All constructs
were confirmed by restriction mapping and dideoxy nucleotide sequencing.
Protein Expression--
E. coli strain BL21(DE3)pLysS
(Stratagene) was transformed with each construct. Luria broth cultures
(500 ml, 37 °C) were grown from a 1:10 dilution of overnight
cultures, and growth was monitored by
A600. Expression was induced by the
addition of IPTG to 1 mM at A600 = 1.6. Cultures were grown for 10-25 min, placed on ice for 10 min, and
harvested by centrifugation (4000 × g, 10 min,
4 °C).
Fusion Protein Purification--
Bacterial cell pellets were
resuspended in 30 ml of "membrane" buffer (1% CHAPS, 20%
glycerol, 50 mM NaCl, 10 mM
dithiothreitol, 20 mM Tris-HCl, pH 8.0) containing
protease inhibitors at the concentrations specified by the manufacturer
(CompleteTM, Boehringer), and passed through a cell
fractionator (Sorvall). Cell debris was removed by centrifugation
(4000 × g, 10 min, 4 °C), and the supernatant was
added to 2 ml of glutathione-conjugated bead slurry (Stratagene). The
tube was rotated at 4 °C overnight to allow binding of
GST-containing proteins to the beads. After extensive washing with
membrane buffer, the beads were transferred to a column (1.5-cm
diameter), and proteins eluted by drop-wise addition of membrane buffer
containing 100 mM reduced glutathione. Fractions (0.5 ml)
were collected and analyzed by SDS-PAGE with Coomassie staining
(27).
Purification of 6K Protein-containing Vesicles--
GST-6K
fusion protein was inserted into vesicles as described previously (17,
21, 28). Vesicle formation was facilitated by removal (via dialysis) of
detergent from a protein/lipid/detergent mixture. Briefly, lipids
1-palmitoyl-2-oleoyl phosphatidylethanolamine (PE),
1-palmitoyl-2-oleoyl phosphatidylcholine (PC), and 1-palmitoyl-2-oleoyl phosphatidylserine (PS) (Avanti Polar Lipids) supplied in
CHCl3 were combined in the mass ratio PE:PC:PS = 3:1:1
and dried under a stream of N2 gas. Purified fusion protein
(0.1 mg/mg total lipid) in membrane buffer supplemented with 400 mg/ml
CHAPS was added to the dried lipids, and the mixture was bath sonicated
(10 min, 20-25 °C). The resulting solution was then transferred
into dialysis tubing (5000 molecular weight cut-off) and dialyzed
against 10 mM TES/200 mM NaCl, pH 7.0 or 8.0, (1 × 1 h, 1l; 1× overnight 1l, 20-25 °C).
Fusion protein-containing vesicles were incubated in the presence of
1-5 units of thrombin (Amersham Biosciences, 1 unit/µl) for 5-16 h
to cleave the GST fusion tag from the 6K protein. GST and uncut fusion
protein were removed by incubation with glutathione-conjugated beads (2 h, 20-25 °C). Thrombin was removed by adsorption to barium citrate
(29). Briefly, 50 µl of 0.109 M sodium citrate was added to 305 µl of 10 mM TES/200 mM NaCl, pH 7.0. Solid BaCl2 was added (15 mg) while vortexing. A cloudy
precipitate of barium citrate forms to which thrombin binds. The
precipitate and bound thrombin were removed by centrifugation.
Following centrifugation, thrombin was undetectable in the supernatant
by SDS-PAGE with silver staining or Western blot with anti-prothrombin antibodies.
Raising and Purifying Antibodies against 6K
Protein--
Peptides corresponding to the 20 N-terminal residues of
BFV 6K (CDTLDDFSYLWTNNQAMFWLQ), the 20 C-terminal residues of BFV 6K
(CACCMKIFLGISGLCVIATQA), the 20 N-terminal residues of RRV 6K
(CASFAETMAYLWDENKTLFWM), and the 20 C-terminal residues of RRV 6K
(CCCCKPFSFLVLLSLGASAKA) were synthesized manually using Boc chemistry
in the Biomolecular Resource Facility at the John Curtin School of
Medical Research, Australian National University. Multiple antigenic
peptides were prepared by coupling peptides to a polylysine core via
their terminal cysteine residues (30). The multiple antigenic peptides
were used to immunize individual New Zealand White rabbits for the
production of polyclonal antisera against peptides representing the N
terminus of BFV 6K (
-B6N), the C terminus of BFV 6K, the N terminus
of RRV 6K (
-R6N), and the C terminus of RRV 6K (
-R6C). Initial
immunization was in Freund's complete adjuvant and subsequent booster
immunizations at 3 and 5 weeks were in Freund's incomplete adjuvant.
Blood samples (10 ml) were collected by ear vein canulation at 6, 8, and 10 weeks postimmunization. Antisera were assayed for specificity by
dot-blot analysis using unconjugated peptides. Affinity chromatography was used to purify antibodies from antisera. Briefly, peptides were
dissolved in 6 M guanidine HCl/10 mM Tris, pH
8.0, reduced with 10 mM dithiothreitol, desalted, (NAD
desalting column), and covalently linked to SulfoLinkTM columns
(Pierce). Columns were gradually returned to more physiological
conditions by sequential washing with PBS containing decreasing amounts
of guanidine hydrochloride. Antisera were applied to the columns, and
after thorough washing, specific antibodies eluted using 100 mM glycine, pH 2.5.
Synthesis and Purification of a Synthetic 6K--
The 58-mer
peptide (DTLDDFSYLWTNNQAMFWLQLASPVAAFLCLSYCCRNLACCMKIFLGISGLCVIATQA)
corresponding to the amino acid sequence of BFV 6K (referred to
hereafter as B6Kpep) was synthesized manually using Boc chemistry in
the Biomolecular Resource Facility at the John Curtin School of Medical
Research, Australian National University. B6Kpep was dissolved in 50%
trifluoroethanol/2 M guanidine isothiocyanate, and dialyzed
into membrane buffer containing 1 M guanidine
isothiocyanate. Peptide refolding was achieved by dialysis into
membrane buffer, and purification was by gel filtration high pressure
liquid chromatography with a BioRad BioSilect SEC400 column with
detection by at 280 nm. Mass spectroscopy, dot-blot, and Western
analyses were used to confirm the identity of the eluted protein (data
not shown).
Western Blot Analysis--
Proteins were transferred from
polyacrylamide gels to polyvinylidene difluoride membranes with a
semi-dry apparatus (Amersham Biosciences). Nonspecific protein binding
sites on the polyvinylidene difluoride membranes were blocked in 10%
(w/v) skim milk proteins in PBS with 0.5% Tween 20 (TPBS). Primary
antibodies were either rabbit antisera (1:100), or affinity purified
antibodies in 10% (w/v) skim milk proteins in TPBS. The secondary
antibody was a goat-raised anti-rabbit IgG alkaline phosphatase
conjugate added in PBS (Sigma), and color development was with Western
Blue-stabilized substrate for alkaline phosphatase (Promega).
Protein Estimation and N-terminal Protein
Sequencing--
Protein estimation was using a bicinchoninic acid
protein assay (Pierce, kit form) in a 96-well plate. Fatty acid-free
bovine serum albumin was used to create standard curves. A Bio-Rad
model 450 microplate reader was used to measure absorbance at 570 nm, with background at 405 nm subtracted. N-terminal protein sequencing was
with an Applied Biosystems 477A machine in the Biomolecular Resource
Facility, John Curtin School of Medical Research.
Electrophysiology--
Vesicles containing purified 6K protein
were fused with lipid bilayers using standard techniques described
previously (17, 21). Briefly, lipids (PE/PC/PS; 3:1:1) supplied in
CHCl3 were dried under a stream of N2 gas,
resuspended in n-decane to 50 mg/ml, and painted over a 120-180-µm
diameter circular hole in a Delrin cup. Bath solutions contained:
trans, 60 mM NaCl, 10 mM TES, pH 7.0 or 8.0, total volume 1 ml; and cis, 10 mM TES
with 510 mM NaCl or 500 mM KCl or 500 mM CaCl2 each buffered to pH 7.0 or 8.0, total
volume 1.3 ml. Currents were measured via AgCl-coated silver wire
electrodes without agar bridges. This can potentially result in large
changes in the junction potential at the electrodes during experiments
(e.g. if the AgCl coating of the electrode becomes chipped).
To control for this possibility, the current between cis and
trans bath solutions was clamped, and the voltage offset
adjusted to zero prior to painting a bilayer. At the conclusion of
every experiment the bilayer was broken, and the current immediately clamped to zero. If the potential difference between chambers was
greater than 10 mV the experiment was discarded. After a good bilayer
had been established, vesicles containing 6K protein were added to the
cis bath. The bath solution was stirred until channel activity was observed. Potential was controlled and current recorded with an Axopatch 200A amplifier. Currents were filtered at 500 Hz,
digitized at 44 kHz (Sony PCM 100), and stored on magnetic tape with a
video cassette recorder. For analysis, currents were replayed through
the same system in reverse, filtered at 1 kHz, and digitized at 2 or 5 kHz by using an A-to-D converter interfaced with a desktop personal
computer. The cis bath was grounded, and voltages are
expressed as trans potential relative to cis.
Reversal potentials were determined by changing the holding potential
in 2-10 mV steps and observing the direction of the currents. For
channel inhibition experiments, antibody was added in small aliquots
(<5 µl; 14 µg/µl), and bath solutions were stirred for 1 min
before recording any effects. The cis bath was set up to
enable perfusion by a pair of back-to-back syringes connected to tubing
the ends of which could be lowered into the cis bath.
Ion Activity Coefficients--
Ion activities for each species
were calculated from the total ionic strength, I, using the
Guy-Chapman "Limiting Law" (31). This could not be used for the
CaCl2 solution because the ionic strength was too high.
Therefore, Ca2+ activities were determined using a
calcium-selective electrode (which gave a linear response in the range
of CaCl2 concentrations used in the bilayer experiments).
Calculation of Relative Ionic Permeabilities--
Relative ionic
permeabilities were determined from reversal potential data and ionic
activities. Reversal potentials were determined as described above and
corrected for liquid junction potential effects. Liquid junction
potentials for differing bath solutions can be calculated using the
Henderson equation (32). The junction potential for a given pair of
dissimilar bath solutions was determined by measuring the voltage
difference (without a bilayer present) between the cis and
trans baths of the bilayer apparatus. This voltage was
measured relative to that obtained from symmetric solutions
(i.e. when the liquid junction potential equals zero). The
potential difference between the two baths (when the current was
clamped to zero) was measured with a 4 M KCl-containing agar bridge electrode. Experimentally measured values were not found to
deviate by more than 2 mV from those predicted by the Henderson
equation. As the Henderson equation is only valid for monovalent
species, the liquid junction potential for the
Ca2+-containing cis solution was determined
experimentally. Once corrected for liquid junction potentials, the sum
of the currents from all ionic species is zero at the reversal
potential, and the constant field equation can be solved. The ionic
activities of the species present (see above for calculation) were used
in conjunction with corrected reversal potential data to iteratively
solve the constant field equation for I = 0 as
described previously (33). Firstly, the
PNa+/PCl
ratio was determined for each channel species by optimizing the
constant field equation to obtain the Na+ permeability
(bath conditions for cis: 510 mM NaCl, 10 mM TES, pH 7.0, and for trans: 60 mM
NaCl, 10 mM TES pH 7.0).
PNa+/PCl
was assumed to remain constant in the presence of other ions
(i.e. when determining K+ and Ca2+
permeabilities). The TES anion was assumed not to permeate the channel.
For calculating ionic activities in the CaCl2 solutions, Ca2+ activity was determined as described above, and the
activity of Cl
was derived from a table of mean activity
coefficients for CaCl2 at a range of molalities (34). As
the mean activity coefficient of a salt solution is the geometrical
mean of the activity coefficients of its component ions, the activity
of Cl
in a CaCl2 solution could be derived.
 |
RESULTS |
Purified, recombinant 6K proteins of RRV and BFV were produced
after expression in E. coli with N-terminal glutathione
S-transferase tags. The cDNA fragments encoding the RRV
or BFV 6K proteins were cloned into the vector p2GEX (described under
"Experimental Procedures"), and optimal expression and purification
methods were determined.
Expression of RRV 6K and BFV 6K Proteins Depresses Bacterial
Growth--
Alphavirus 6K proteins contain a large proportion of
hydrophobic residues (see Fig. 1) and
have been shown to interact with membranes in virus-infected cells (1,
3, 35). To examine potential toxicity of the RRV and BFV 6K proteins in
E. coli, we monitored the growth of cultures expressing
GST-6K fusion proteins. Induction of GST-6K expression with IPTG
rapidly led to arrest of E. coli cell growth. Cultures of
E. coli expressing RR 6K fusion protein, induced during the
log phase of growth, continued to grow for only 10 min postinduction
(Fig. 2). In contrast, control cultures
(uninduced or expressing unfused GST from p2GEX) continued to grow for
over 2 h (p2GEX not shown for clarity). Fig. 2 shows combined
results from seven induced cultures expressing RRV 6K compared with
five uninduced cultures. Similar depression of growth was observed in
E. coli expressing BFV 6K protein (data not shown). This
indicates that expression of the 6K fusion protein inhibits growth of
E. coli and is consistent with the findings of Sanz et
al. (4) that SFV 6K protein enhances membrane permeability in
bacteria.

View larger version (16K):
[in this window]
[in a new window]
|
Fig. 1.
A, homology comparison of 6K proteins.
Identical residues are shown in gray boxes, homologous
residues are shown in plain boxes. The ClustalW program was
used (as part of the MacVector 6.0 software suite) with the BLOSUM 30 matrix, open gap penalty = 10, extended gap penalty = 0.05, delay divergent = 40%. B, transmembrane prediction for
BFV and RRV 6K proteins. The probability of a residue being located in
a transmembrane helix (TM p) is plotted against amino acid
sequence no. using the TMHMM algorithm (23), N terminus = 1).
C, hydrophobicity plot for BFV and RRV 6K proteins.
Hydrophobic regions are above the baseline, hydrophilic regions are
below (Kyte-Doolittle hydrophobicity scale, window size: seven amino
acids).
|
|

View larger version (12K):
[in this window]
[in a new window]
|
Fig. 2.
Expression of RRV GST-6K fusion
depresses E. coli growth. Bacterial growth was
measured by optical density at 600 nm in cultures of E. coli
strain BL21 pLysS(DE3). Averaged data from five uninduced "control"
cultures (open squares) and seven cultures exposed at 120 min to 1 mM IPTG to induce expression of RRV GST-6K fusion
protein (filled squares) are plotted against time from start of
culturing. Vertical bars show ± 1 S.D. where extending
beyond symbols.
|
|
Purification of RRV GST-6K and BFV GST-6K Fusion
Proteins--
GST-6K fusion proteins of BFV and RRV were purified from
E. coli extracts as described under "Experimental
Procedures." SDS-PAGE was used to assess the efficiency of different
steps throughout purification. Coomassie staining of extracts from
bacteria expressing RRV GST-6K that had been purified on glutathione
columns revealed the major constituents to be proteins of molecular
masses 28 kDa and 34 kDa (Fig.
3A). The 28-kDa protein was
immunoreactive to anti-GST antibodies on a Western blot (not shown) and
represents "free" GST expressed from the unfused copy of the gene
in the expression plasmid. The 34-kDa protein was also immunoreactive with anti-GST antibodies, and its size corresponds to that expected for
the RRV GST-6K fusion protein. Surprisingly, the 34-kDa protein was not
recognized by polyclonal antibodies raised against the N-terminal 20 amino acids of RRV 6K. Rather, a single protein of a molecular mass of
~32 kDa was immunoreactive to the anti-RRV 6K N-terminal antibodies
(Fig. 3B). The 32-kDa protein was of much lower abundance
than the 34-kDa protein and most likely represents a truncated form of
the RRV 6K fusion protein. Unfused GST was present in about 16-fold
excess compared with the full-length protein (determined by Coomassie
staining of serial dilutions of the RRV GST-6K fusion protein, data not
shown). Fusion protein expression was thereby calculated to be ~1.7
mg/liter of LB culture after bicinchoninic acid assay of total protein
(data not shown). Similar results and yields were obtained from cells
expressing the BFV GST-6K fusion protein, except that no truncated
protein was detected.

View larger version (35K):
[in this window]
[in a new window]
|
Fig. 3.
Purification of bacterially expressed BFV and
RRV 6K proteins. A, Coomassie stained SDS-PAGE of BFV GST-6K
fusion protein before and after thrombin digestion. Lane 1 contains fusion protein eluted with 100 mM reduced
glutathione from glutathione-agarose beads. Lane 2 contains
fusion protein 12 h after addition of thrombin. B,
Western blot of glutathione-eluted BFV GST-6K fusion protein
(equivalent to sample in lane 1 of A). The
primary incubation was with serum (diluted 1:100) raised against the
BFV 6K N-terminal 20 residues. (see "Experimental Procedures").
C, silver-stained SDS-PAGE of purification of bacterially
expressed BFV 6K. Lane 1 contains proteins eluted with 100 mM reduced glutathione from glutathione-agarose beads.
Lane 2 contains thrombin-digested fusion protein. Lane
3 contains purified BFV 6K protein. The markers on the
left indicate molecular masses (kDa). D,
silver-stained SDS-PAGE of purification of bacterially expressed RRV
6K. Lane 1 contains whole bacterial cell lysate. Lane
2 contains proteins eluted with 100 mM reduced
glutathione from glutathione-agarose beads. Lane 3 contains
purified RRV 6K protein. The markers on the right indicate
molecular masses (kDa).
|
|
Preparation of Pure 6K Protein in Phospholipid
Vesicles--
Attempts to cleave either BFV GST-6K or RRV GST-6K in
detergent-containing extracts were unsuccessful despite modification of
the following parameters: amount of thrombin present (0.05-0.5 units/µl), incubation time (2-72 h), temperature (4-50 °C), or the presence of up to 30% organic solvent (TFE or acetonitrile). However, it was possible to cleave both RRV GST-6K and BFV
GST-6K if the fusion proteins were associated with lipid vesicles
prior to the addition of thrombin. The final purification
step yields protein-containing vesicles that appear on silver-stained
SDS gels as a single protein of 5.8 kDa for both RRV 6K and BFV 6K (Fig. 3, C and D, respectively). N-terminal
sequencing of the 5.8-kDa protein prepared from RRV 6K fusion revealed
the first seven amino acids to be identical to those expected of
wild-type RRV 6K protein. The 5.8-kDa protein band from the BFV 6K
preparation was not sequenced. Uncut fusion protein, GST, and other
protein contaminants were undetectable by silver staining (Fig.
3C, lane 3 and Fig. 3D, lane
3) or Western blot (not shown). Thus the final preparation was
deemed to be a homogeneous collection of RRV or BFV 6K-containing vesicles.
RRV 6K Ion Channel Properties--
Ion channel activity of
preparations containing 6K protein was assessed by the planar lipid
bilayer method (see "Experimental Procedures"). When planar lipid
bilayers were exposed to vesicles containing the RRV 6K protein, ion
currents were observed in 83 experiments using protein from five
separate purifications. The average incorporation time was 76 s.
When no protein was added to the solutions, no activity was seen
(n = 20, total waiting time = 90 min). Very little
protein was required to form channels (e.g. 2 ng of RRV 6K
protein introduced to the cis chamber was sufficient).
Typical current traces are shown in Fig.
4A in which the currents
generated by the RRV 6K protein can be seen to reverse between +30 and
+60 mV, indicating a preference for Na+ over
Cl
. Average reversal potential data from a number of
experiments are displayed in Table I.

View larger version (17K):
[in this window]
[in a new window]
|
Fig. 4.
RRV 6K ion channel activity. A,
channel activity is shown over a range of potentials. The closed state
is shown as a solid line, openings are deviations from this
line. Scale bars are 500 ms and 10 pA. Buffer conditions
were cis: 510 mM NaCl, 10 mM TES, pH
7.0; trans: 60 mM NaCl, 10 mM TES,
pH 7.0. B, voltage-dependent activity of
bacterially expressed RRV 6K channels. Holding potential is indicated
(above). The closed channel level is indicated by a dashed
line. Openings are deviations from the baseline. A dramatic
increase in channel activity can be seen upon switching to -100 mV.
Scale bars are 1 s and 10 pA.
|
|
The open probability of RRV 6K channels was found to be
voltage-dependent. Channels were much more active at -100
mV than at 100 mV (Fig. 4B). A channel that was closed at
positive holding potentials could often be reactivated by switching to
negative holding potentials.
The permeability of RRV 6K channels to cations other than
Na+ was tested by changing the solution in the
cis bath to either KCl or CaCl2 while
maintaining the holding potential at -100 mV. When the cis
chamber contained potassium or calcium ions, currents were still
observed. Thus, the channels were also permeable to the cations
K+ and Ca2+. To determine the relative
permeabilities of Na+, K+, Ca2+ and
Cl
, reversal potential data were corrected for liquid
junction potentials and then inserted into the Constant Field equation
(described under "Experimental Procedures"). It was found that the
permeability sequence for RRV 6K channels was Na+ > K+ > Ca2+
Cl
. Ionic
permeability ratios are given in Table I.
Antibodies Selectively Inhibit RRV 6K Channels--
Polyclonal
antibodies raised in rabbits immunized with synthetic peptides
corresponding to the N or C termini of RRV 6K protein were used to
confirm that the 6K protein was indeed the channel-forming molecule in
preparations of the purified recombinant protein.
When antibody raised against the N-terminal 20 amino acids of RRV 6K
was added to the cis chamber, a reduction in current to
baseline levels occurred (n = 8, Fig.
5A). The same antibody had no
effect when added to the trans chamber (n = 5, not shown).

View larger version (23K):
[in this window]
[in a new window]
|
Fig. 5.
Inhibition of channel activity by
chamber-specific addition of antibodies. A, channel activity
is shown before (control), and after (+ -R6N) addition of anti-RRV
6K N terminus antibody to the cis chamber. B,
channel activity is shown before (control) and after (+ -R6C)
addition of anti-RRV 6K C terminus antibody to the trans
chamber. A dashed line represents the closed (baseline)
state. Channel openings are downward deflections from the baseline.
C, D, all points histograms showing the effect of
antibodies on RRV 6K channels. Paired histograms are shown before
(above, "RRV channel activity") and after addition of antibody to
the stated chamber (below). C, anti-RRV 6K N terminus
( -R6N) was added to the cis chamber. D,
anti-RRV 6K C-terminus ( -R6C) was added to the trans
chamber. Current amplitude probability histograms were generated from
30 s of record. NB, baseline current = 0 pA.
|
|
Conversely, antibody against the C-terminal of RRV 6K inhibited channel
openings when added to the trans bath (n = 6, Fig. 5B), but not the cis bath
(n = 7, not shown). All points histograms of currents
recorded before and after addition of antibody are shown in Fig. 5,
C and D. This chamber-dependent
effect of the antibodies demonstrates that channel inhibition was
specific to the particular epitope recognized by the antibody. Further,
the results indicate that the RRV 6K protein is oriented in the
vesicles with the N-terminus facing the outside and the C-terminus the inside. When placed in the cis solution, vesicles fuse with
a bilayer so that the part of a transmembrane protein that faces the
outside of the vesicle will face the cis solution (36).
GST and Uncut RRV GST-6K Fusion Protein Do Not Form Ion
Channels--
Unfused GST was obtained from a bacterial culture
expressing p2GEX using the purification procedure devised for 6K. The
purified GST was "inserted" into vesicles and incubated with
thrombin. The GST protein did not make channels in the bilayer system
(n = 5, total time waiting for channel activity = 1 h). In a similar manner, uncut RRV GST-6K fusion protein was
tested and found not to have any ion channel activity
(n = 5, total time waiting for channel activity = 1.5 h). The GST and uncut fusion protein (control) experiments
were only performed on days that vesicles were incorporating into the
bilayer quickly (consistent incorporation in under 30 s).
BFV 6K Also Forms Ion Channels--
BFV 6K protein was purified
and inserted into planar lipid bilayers essentially as described for
RRV 6K. Channel currents were observed in 35 experiments using protein
from three separate purifications. When no protein was added to the
solutions, no channel activity was seen (n = 15, total
time = 70 min). Typical traces recorded are shown in Fig.
6A. As found for RRV 6K
channels, the reversal potential of BFV 6K channels lay between +30 and +60 mV (Table I).

View larger version (12K):
[in this window]
[in a new window]
|
Fig. 6.
BFV 6K ion channels. A, channel
activity is shown for a range of potentials. The closed state is shown
as a solid line. Openings are deviations from this line.
Scale bars are 500 ms and 10 pA. Solutions contained
cis: 510 mM NaCl, 10 mM TES, pH 7.0;
trans: 60 mM NaCl, 10 mM TES, pH
7.0. B, current-voltage relationship for bacterially
expressed BFV 6K. Largest single opening events of a single channel are
plotted for each holding potential. Solutions were the same as used in
A.
|
|
The current-voltage relationship for BFV 6K channels from one
experiment is shown in Fig. 6B. The largest single channel
currents are plotted against the potential at which they were recorded. The channels can be seen to have a linear current-voltage relationship with a reversal potential close to +40 mV.
Ionic permeability ratios for BFV 6K are given in Table I. The ion
selectivity of BFV 6K channels was similar to that of RRV 6K ion
channels: Na+ > K+ > Ca2+
Cl
. The
PNa+/PCl
and PNa+/PK+ ratios were also similar for channels formed by BFV and RRV 6K proteins, indicating an approximate 15-fold preference for
Na+ over Cl
, and a slight (1.3-fold)
preference for Na+ over K+. However, in
comparison to RRV 6K, the BFV 6K channels showed 2-fold greater
selectivity for Na+ over Ca2+ (Table I).
It was thought that the wide range of channel conductances observed
might correlate with alteration of the number of subunits in 6K
channels. In an effort to create channels with different numbers of
subunits, we made vesicle preparations with varying amounts of fusion
protein per milligram of lipid. The conductance of BFV 6K channels was
found to correlate with the amount of protein added/mg of lipid.
However, there was considerable overlap in the conductances of
individual channels from different vesicle preparations. Channels were
observed with conductances in the range 40-800 picosiemens.
Antibodies Selectively Inhibit BFV 6K Channels--
When antibody
raised against the N-terminal of BFV 6K was added to the cis
chamber, a reduction in mean channel current occurred in nine of 10 experiments. Typical results are shown in Fig.
7. Channel activity before addition of
the antibody can be seen in Fig. 7A
(control). Addition of the N-terminal antibody to the cis chamber blocked all channel activity (Fig. 7, A
and B). Upon washing the antibody out of the
cis bath by perfusion, channel activity reappeared (Fig.
7A, washout). Similar results were obtained in
three experiments. No effect on channel activity was observed when the
BFV 6K N-terminal antibody was applied to the trans bath (n = 5, data not shown). All points histograms for
30 s of data are shown in Fig. 7B. Unfortunately,
attempts to purify an antibody against the C-terminal of BFV 6K by
affinity chromatography were unsuccessful.

View larger version (16K):
[in this window]
[in a new window]
|
Fig. 7.
N-terminal antibody inhibition of
BFV 6K channels. A, channel activity is shown before
(control), and after (+ -B6N) addition of anti-BFV 6K
N-terminal antibody to the cis chamber. Channel activity is
restored by perfusion of the cis chamber
(washout). The channel closed state (C) is
represented by a solid line. The holding potential was -100
mV. Solutions contained cis: 510 mM NaCl, 10 mM TES, pH 7.0; trans: 60 mM NaCl,
10 mM TES, pH 7.0. B, all points histograms show
the effect of antibody on BFV 6K channels. Paired records are shown
before (Pre-Ab) and after (+ -B6N) addition of anti-RRV
6K N terminus antibody to the cis chamber. Current amplitude
probability histograms were generated from 30 s of record.
NB, baseline current = 0 pA.
|
|
Addition of a control antibody raised against a pentahistidine peptide
did not result in channel inhibition when added to either bath (data
not shown). This demonstrates that channel inhibition was specific to
the particular antigen recognized by the antibody.
BFV 6K Synthetic Peptide Forms Ion Channels--
A synthetic
peptide corresponding to the entire amino acid sequence of BFV 6K
protein (B6Kpep) was purified, inserted into vesicles and added to
bilayers as described under "Experimental Procedures." The peptide
formed cation-selective channels with properties similar to those of
the recombinant BFV 6K protein. Channels were seen in 42 experiments
from seven separate purifications of B6Kpep. Typical records are shown
in Fig. 8. The reversal potential of
B6Kpep channels was +35 ± 1 mV (n = 12, cf. +48 ± 2 mV for BFV 6K). The channels could be
blocked by addition to the cis chamber of antibody raised to
the N-terminal 20 amino acids of BFV 6K. Perfusion of the
cis chamber to wash out the antibody relieved channel
inhibition (data not shown). As the synthetic peptide was devoid of
E. coli contaminants, these results confirm that the ion
channel activity seen in recombinant preparations of GST-6K was indeed
due to the 6K protein.

View larger version (13K):
[in this window]
[in a new window]
|
Fig. 8.
Channels formed by a BFV 6K synthetic
peptide. Openings are shown to dashed lines at +70 and
-100 mV. Scale bars are 500 ms and 15 pA. Buffer conditions
were cis: 510 mM NaCl, 10 mM TES, pH
7.0; trans: 60 mM NaCl, 10 mM TES,
pH 7.0.
|
|
A Point Mutation in BFV 6K Alters Ion Channel Properties--
In
an attempt to cause a major change in ion channel activity and thus
further confirm the link between channel activity and the BFV 6K
protein, we mutated serine 32 to proline. Serine 32 of BFV 6K is
positioned at the C-terminal side of the predicted transmembrane region
of the protein (23). This residue has a potential role in ion
permeation because of its polar nature. Additionally, insertion of
proline might be expected to disrupt the channel's active conformation
as proline is known to be a "helix breaker" (37). Protein from
seven separate purifications generated currents in 91 experiments.
When Ser-32 of BFV 6K was mutated to Pro, the reversal potential of the
channels with CaCl2-containing cis bath solution
changed from +4.3 to +12.7 mV. This corresponds to a significant drop (p < 0.001) in the
PNa+/PCa2+ permeability ratio from 6.2 to 3.6 (Table I). A loss of Na+
selectivity is indicated by a reduction of
PNa+/PK+ from
1.3 in wild-type BFV 6K, to 1.0 in BFV 6K (S32P) (p < 0.01). The change of channel properties caused by specific alteration of a single amino acid in the BFV 6K sequence also confirms that the
observed ion channel activity is indeed due to 6K and not a contaminant.
 |
DISCUSSION |
We have shown that the 6K proteins of two alphaviruses, RRV and
BFV, form cation-selective ion channels in planar lipid bilayers. As
well as the high purity of the final preparations, a number of other
experiments established that the currents observed were caused by the
6K proteins and were not due to an unidentified contaminant E. coli protein. Firstly, antibodies raised against the N and C
termini of the 6K proteins modulated channel activity. Secondly, a
single nucleotide substitution (S32P) was sufficient to modify the
calcium permeability of BFV 6K protein. Thirdly, a synthetic peptide
corresponding to the amino acid sequence of the BFV 6K protein formed
ion channels with similar properties. Modulation of the synthetic
peptide channels by the N- and C-terminal antibodies was identical to
modulation of channels formed by bacterially expressed BFV 6K protein.
Finally, E. coli extracts of neither uncleaved GST-6K fusion
proteins nor GST alone contained molecules that caused ion channel activity.
Orientation of 6K in Bilayers--
The use of affinity-purified
antibodies to specifically inhibit channel currents from both sides of
the bilayer (Figs. 5 and 7) supports our conclusion that the 6K protein
forms an ion channel. The chamber-specific effect of antibody
inhibition suggests further that 6K proteins are oriented in bilayers
with the N-terminal facing the cis bath, and the C-terminal
facing the trans bath. Given the length of the 6K
polypeptide chain, location of N and C termini on opposite sides of the
membrane suggests that the hydrophobic domain consists of a single
transmembrane
-helix.
Our evidence that 6K has a single transmembrane domain is in contrast
with earlier results suggesting that 6K crosses the membrane twice,
with both termini exposed to the lumen of the ER (1, 38). However,
these data do not exclude the possibility that the C-terminus of 6K is
only transiently located in the ER lumen. The C-terminus of the E2
protein of Sindbis virus has been shown to retract through the ER
membrane following cleavage by the signalase enzyme (39). A similar
retraction of the C-terminal of the RRV and BFV 6K proteins may occur
following cleavage by signalase.
Thrombin cleavage of GST-6K fusion proteins did not occur in solutions
containing detergent. Thrombin must be unable to access its cleavage
site under these conditions, perhaps because it is buried in the folded
conformation of the fusion protein. This steric hindrance may also
explain the inability of antibodies against BFV and RRV N termini to
recognize full-length fusion protein on Western blots (see Fig.
3A). Because 6K is an integral membrane protein, it is
possible that it adopts its native conformation only in a lipidic
environment. Indeed, association of GST-6K fusion proteins with lipid
vesicles prior to the addition of thrombin resulted in successful
cleavage, indicating that some conformational change had occurred in
the 6K protein. Even when in vesicles, relatively large amounts of
thrombin were required to cleave fusion proteins to completion (Fig.
3A), again presumably due to restricted access of thrombin
to its cleavage site. However, the fact that thrombin digestion
proceeded to completion. i.e. complete disappearance of the
34-kDa band corresponding to GST-6K) indicates that the N termini of
the 6K proteins are all located exterior to vesicles.
Comparison of 6K Channel Properties--
The low sequence identity
between alphavirus 6K proteins (7% by sequence alignment) is perhaps
reflected in some of the differing properties of RRV and BFV channels
(see Figs. 4A, 6A, and Table I). Broader features
of the 6K ion channels studied are similar, however. Both are cation
channels, they have similar reversal potentials, and both show strong
activation at negative voltages.
A Point Mutation in BFV 6K Alters Channel
Properties--
Transmembrane peptide domains are often characterized
by a hydrophobic,
-helical core that is "anchored" at the
membrane surface by more polar residues (40). Polar residues within
transmembrane domains of ion channels are thought to form an
aqueous-lined pore for ion conduction (41). In choosing to make the
mutation S32P in the BFV 6K protein, we sought to introduce a major
structural change within the transmembrane domain as well as removing a
potential cation-interacting residue. In similarity with residue serine 24 of the Vpu protein of HIV-1, residue serine 32 of BFV 6K protein is
located at the C terminus end of a putative transmembrane helix. Serine
24 of Vpu is predicted to face the channel pore and thought to have a
role in gating and/or selectivity of the channel (42). BFV 6K channels
containing the S32P mutation were less cation-selective than wild-type
channels, and the
PNa+/PCa2+ ratio was decreased (see Table I). These changes were consistent with a
gating/selectivity role for serine 32 in BFV 6K channels.
What Role Does 6K Ion Channel Activity Play in Virus
Replication?--
Alphavirus proteins are associated with cellular
membranes at several stages of the infection cycle. It would be
interesting to know the intracellular location of 6K ion channel
activity. Early events in infection (binding and internalization) can
be excluded as they do not require 6K protein (5, 43). The E1 protein
of SFV has been shown to catalyze acid-induced fusion of membranes
(43). Ion channel activity of 6K is therefore unlikely to be required
for membrane fusion in the endosome (contrasting with the M2 protein of
influenza A) (22). A membrane-impermeable biotinylation reagent has
been used to label primary amines of the glycoproteins of SFV-infected
BHK cells (44). Precipitation of biotin-labeled proteins on immobilized
streptavidin-agarose suggested that 6K is associated with glycoproteins
at the cell surface (44). Further indirect evidence that the 6K protein proceeds to the cell membrane is provided by immunoprecipitation of
purified SINV virus with antibodies against the E2 glycoprotein; trace
amounts of coprecipitated 6K suggest that the protein must have been at
the plasma membrane prior to budding into virions (45). Thus, the
subcellular location of 6K ion channel activity could be the ER, Golgi,
trans-Golgi network, or plasma membrane.
A variety of cellular effects have been observed following
site-directed mutation of alphavirus 6K protein. Defects have been found in the areas of glycoprotein processing and trafficking, virus
assembly, and budding. Deletion mutants of 6K protein of Sindbis (21 amino acid deletion) and Semliki Forest viruses (full deletion) depress
virus replication (10, 46), possibly by interfering with glycosylation
and trafficking of proteins through the ER (10, 47). Defects at the
level of budding are common: nucleocapsids accumulate at the plasma
membrane of 6K-deleted SFV (6). Virions failed to fully pinch off from
the plasma membrane when a 21-amino acid deletion was introduced to the
6K protein of SINV (10). In the only mutagenesis experiment on 6K that
involved insertion of amino acids, cleavage of the SINV structural
polyprotein precursor was retarded (48). No gross structural
abnormalities have been noted in 6K-deleted virions although, in SFV,
the mutant virions are more heat-labile (6). Budding defects caused by
point mutations in 6K can be rescued by a second-site mutation in
glycoprotein E2 (38), hinting at an interrelationship between 6K, the
E2 protein, and lipid (10). Budding defects have additionally been
noted when SINV 6K cysteine residues that normally acquire a palmitoyl
group are mutated (8).
Following the onset of viral RNA translation in alphavirus-infected
cells, the plasma membrane becomes more permeable to monovalent cations
(49). This is followed by an increase in permeability to larger
molecules, such as translation inhibitors (50). It is possible that the
ion channels formed by 6K proteins are responsible for both of these
changes. The wide range of conductance values obtained for 6K channels
may reflect the protein's ability (as infection proceeds) to form
channels with larger pores and conductances. Certainly, RRV and BFV 6K
channels are several-fold more permeable to monovalent cations than
divalent cations, and the plasma membrane potential would stimulate 6K
ion channel activity. Vesicles containing viral proteins proceed
through the secretory pathway of infected cells and fuse with the
plasma membrane so that the N-terminal becomes exterior to the cell. A
holding potential of -100 mV in the bilayer setup approximates the
membrane potential of cells with respect to orientation of the 6K
protein and dramatically activates 6K ion channels (see Fig.
4B). Thus, the ion channel activity of any 6K protein
reaching the plasma membrane would be activated by the membrane potential.
The 6K protein has been shown to have a role in virus replication
in vitro (6, 10). A drug that blocked 6K ion channels could
be used to obtain further understanding of the role and subcellular
location of 6K ion channel activity in alphavirus infection.
 |
FOOTNOTES |
*
The costs of publication of this
article were defrayed in part by the
payment of page charges. The article
must therefore be hereby marked
"advertisement" in
accordance with 18 U.S.C. Section
1734 solely to indicate this fact.
**
To whom correspondence should be addressed. Tel.:
612-6125-2893; Fax: 612-6125-4761; E-mail:
Peter.Gage@anu.edu.au.
Published, JBC Papers in Press, September 12, 2002, DOI 10.1074/jbc.M207847200
 |
ABBREVIATIONS |
The abbreviations used are:
RRV, Ross River
virus;
BFV, Barmah Forest virus;
CHAPS, (3-[(3-cholamidopropyl)
dimethylammonio]-1-propane-sulfonate);
GST, Schistosoma
japonicum glutathione S-transferase;
IPTG, isopropyl-
-D-thiogalactopyranoside;
PC, 1-palmitoyl-2-oleoyl phosphatidylcholine;
PE, 1-palmitoyl-2-oleoyl phosphatidylethanolamine;
PS, 1-palmitoyl-2-oleoyl
phosphatidylserine;
SFV, Semliki Forest virus;
SINV, Sindbis virus;
TES, 2-([2-hydroxy-1,1-bis(hydroxymethyl)-ethyl]amino)ethanesulfonic acid);
TFE, 2,2,2-trifluoroethanol;
ER, endoplasmic reticulum;
PBS, phosphate-buffered saline.
 |
REFERENCES |
| 1.
|
Liljestrom, P.,
and Garoff, H.
(1991)
J. Virol.
65,
147-154[Abstract/Free Full Text]
|
| 2.
|
Strauss, J. H.,
and Strauss, E. G.
(1994)
Microbiol. Rev.
58,
491-562[Abstract/Free Full Text]
|
| 3.
|
Welch, W. J.,
and Sefton, B. M.
(1980)
J. Virol.
33,
230-237[Abstract/Free Full Text]
|
| 4.
|
Sanz, M. A.,
Perez, L.,
and Carrasco, L.
(1994)
J. Biol. Chem.
269,
12106-12110[Abstract/Free Full Text]
|
| 5.
|
Liljestrom, P.,
Lusa, S.,
Huylebroeck, D.,
and Garoff, H.
(1991)
J. Virol.
65,
4107-4113[Abstract/Free Full Text]
|
| 6.
|
Loewy, A.,
Smyth, J.,
von Bonsdorff, C. H.,
Liljestrom, P.,
and Schlesinger, M. J.
(1995)
J. Virol.
69,
469-475[Abstract]
|
| 7.
|
Ivanova, L.,
Lustig, S.,
and Schlesinger, M. J.
(1995)
Virology
206,
1027-1034[CrossRef][Medline]
[Order article via Infotrieve]
|
| 8.
|
Gaedigk-Nitschko, K.,
Ding, M. X.,
Levy, M. A.,
and Schlesinger, M. J.
(1990)
Virology
175,
282-291[CrossRef][Medline]
[Order article via Infotrieve]
|
| 9.
|
Carrasco, L.
(1995)
Adv. Virus Res.
45,
61-93[Medline]
[Order article via Infotrieve]
|
| 10.
|
Sanz, M. A.,
and Carrasco, L.
(2001)
J. Virol.
75,
7778-7784[Abstract/Free Full Text]
|
| 11.
|
van Kuppeveld, F. J.,
Hoenderop, J. G.,
Smeets, R. L.,
Willems, P. H.,
Dijkman, H. B.,
Galama, J. M.,
and Melchers, W. J.
(1997)
EMBO J.
16,
3519-3532[CrossRef][Medline]
[Order article via Infotrieve]
|
| 12.
|
Sakaguchi, T.,
Leser, G. P.,
and Lamb, R. A.
(1996)
J. Cell Biol.
133,
733-747[Abstract/Free Full Text]
|
| 13.
|
Yao, J. S.,
Strauss, E. G.,
and Strauss, J. H.
(1996)
J. Virol.
70,
7910-7920[Abstract]
|
| 14.
|
Guinea, R.,
and Carrasco, L.
(1994)
FEBS Lett.
343,
242-246[CrossRef][Medline]
[Order article via Infotrieve]
|
| 15.
|
Pinto, L. H.,
Holsinger, L. J.,
and Lamb, R. A.
(1992)
Cell
69,
517-528[CrossRef][Medline]
[Order article via Infotrieve]
|
| 16.
|
Sunstrom, N. A.,
Premkumar, L. S.,
Premkumar, A.,
Ewart, G.,
Cox, G. B.,
and Gage, P. W.
(1996)
J. Membr. Biol.
150,
127-132[CrossRef][Medline]
[Order article via Infotrieve]
|
| 17.
|
Ewart, G. D.,
Sutherland, T.,
Gage, P. W.,
and Cox, G. B.
(1996)
J. Virol.
70,
7108-7115[Abstract/Free Full Text]
|
| 18.
|
Gonzalez, M. E.,
and Carrasco, L.
(1998)
Biochemistry
37,
13710-13719[CrossRef][Medline]
[Order article via Infotrieve]
|
| 19.
|
Lama, J.,
and Carrasco, L.
(1992)
Biochem. Biophys. Res. Commun.
188,
972-981[CrossRef][Medline]
[Order article via Infotrieve]
|
| 20.
|
Lama, J.,
and Carrasco, L.
(1992)
J. Biol. Chem.
267,
15932-15937[Abstract/Free Full Text]
|
| 21.
|
Piller, S. C.,
Ewart, G. D.,
Premkumar, A.,
Cox, G. B.,
and Gage, P. W.
(1996)
Proc. Natl. Acad. Sci. U. S. A.
93,
111-115[Abstract/Free Full Text]
|
| 22.
|
Hay, A. J.
(1992)
Semin. Virol.
3,
21-30
|
| 23.
|
Sonnhammer, E. L.,
von Heijne, G.,
and Krogh, A.
(1998)
Proc. Int. Conf. Intell. Syst. Mol. Biol.
6,
175-182[Medline]
[Order article via Infotrieve]
|
| 24.
|
Lee, E.,
Stocks, C.,
Lobigs, P.,
Hislop, A.,
Straub, J.,
Marshall, I.,
Weir, R.,
and Dalgarno, L.
(1997)
Virology
227,
509-514[CrossRef][Medline]
[Order article via Infotrieve]
|
| 25.
|
Kuhn, R. J.,
Niesters, H. G.,
Hong, Z.,
and Strauss, J. H.
(1991)
Virology
182,
430-441[CrossRef][Medline]
[Order article via Infotrieve]
|
| 26.
|
Sambrook, J.,
Fritsch, E. F.,
and Maniatis, T.
(1989)
Molecular Cloning: A Laboratory Manual
, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY
|
| 27.
|
Laemmli, U. K.
(1970)
Nature
227,
680-685[CrossRef][Medline]
[Order article via Infotrieve]
|
| 28.
|
New, R. R. C.
(1990)
Liposomes: A Practical Approach
, pp. 33-104, IRL Press, New York
|
| 29.
|
Board, P. G.,
and Shaw, D. C.
(1983)
Br. J. Haematol.
54,
245-254[Medline]
[Order article via Infotrieve]
|
| 30.
|
Lu, Y. A.,
Clavijo, P.,
Galantino, M.,
Shen, Z. Y.,
Liu, W.,
and Tam, J. P.
(1991)
Mol. Immunol
28,
623-630[CrossRef][Medline]
[Order article via Infotrieve]
|
| 31.
|
Margolis, M. J.
(1966)
Chemical Principles in Calculation of Ionic Equilibria
, p. 270, Macmillan, New York
|
| 32.
|
Barry, P. H.,
and Lynch, J. W.
(1991)
J. Membr. Biol.
121,
101-117[CrossRef][Medline]
[Order article via Infotrieve]
|
| 33.
|
Goldman, D. E.
(1943)
J. Gen. Physiol.
27,
37-60[Abstract/Free Full Text]
|
| 34.
|
Staples, B. R.,
and Nuttall, R. L.
(1977)
J. Phys. Chem. Ref. Data
6,
385-407
|
| 35.
|
Garoff, H.,
Huylebroeck, D.,
Robinson, A.,
Tillman, U.,
and Liljestrom, P.
(1990)
J. Cell Biol.
111,
867-876[Abstract/Free Full Text]
|
| 36.
|
Hanke, W.
(1998)
in
Ion Channel Reconstitution
(Miller, C., ed)
, pp. 141-156, Plenum Publishing Corp., New York
|
| 37.
|
Altmann, K. H.,
Wojcik, J.,
Vasquez, M.,
and Scheraga, H. A.
(1990)
Biopolymers
30,
107-120[CrossRef][Medline]
[Order article via Infotrieve]
|
| 38.
|
Ivanova, L., Le, L.,
and Schlesinger, M. J.
(1995)
Virus Res.
39,
165-179[CrossRef][Medline]
[Order article via Infotrieve]
|
| 39.
|
Ivanova, L., Le, L.,
and Schlesinger, M. J.
(1993)
J. Virol.
67,
2546-2551[Abstract/Free Full Text]
|
| 40.
|
Fischer, W. B.,
Forrest, L. R.,
Smith, G. R.,
and Sansom, M. S.
(2000)
Biopolymers
53,
529-538[CrossRef][Medline]
[Order article via Infotrieve]
|
| 41.
|
Hille, B.
(1992)
Ionic Channels of Excitable Membranes
, 2nd Ed.
, pp. 236-258, Sinauer Associates Inc., Sunderland, MA
|
| 42.
|
Cordes, F. S.,
Kukol, A.,
Forrest, L. R.,
Arkin, I. T.,
Sansom, M. S.,
and Fischer, W. B.
(2001)
Biochim. Biophys. Acta
1512,
291-298[Medline]
[Order article via Infotrieve]
|
| 43.
|
Dick, M.,
Barth, B. U.,
and Kempf, C.
(1996)
Virology
220,
204-207[CrossRef][Medline]
[Order article via Infotrieve]
|
| 44.
|
Lusa, S.,
Garoff, H.,
and Liljestrom, P.
(1991)
Virology
185,
843-846[CrossRef][Medline]
[Order article via Infotrieve]
|
| 45.
|
Gaedigk-Nitschko, K.,
and Schlesinger, M. J.
(1990)
Virology
175,
274-281[CrossRef][Medline]
[Order article via Infotrieve]
|
| 46.
|
Gonzalez, M. E.,
and Carrasco, L.
(2001)
Virology
279,
201-209[CrossRef][Medline]
[Order article via Infotrieve]
|
| 47.
|
Gaedigk-Nitschko, K.,
and Schlesinger, M. J.
(1991)
Virology
183,
206-214[CrossRef][Medline]
[Order article via Infotrieve]
|
| 48.
|
Schlesinger, M. J.,
London, S. D.,
and Ryan, C.
|