|
Originally published In Press as doi:10.1074/jbc.M206136200 on November 14, 2002
J. Biol. Chem., Vol. 278, Issue 6, 3536-3544, February 7, 2003
Expression and Characterization of Recombinant Human
UDP-glucuronosyltransferases (UGTs)
UGT1A9 IS MORE RESISTANT TO DETERGENT INHIBITION THAN THE
OTHER UGTs AND WAS PURIFIED AS AN ACTIVE DIMERIC
ENZYME*
Mika
Kurkela ,
J. Arturo
García-Horsman §,
Leena
Luukkanen ,
Saila
Mörsky ,
Jyrki
Taskinen ¶,
Marc
Baumann ,
Risto
Kostiainen ¶,
Jouni
Hirvonen ¶, and
Moshe
Finel **
From the Viikki Drug Discovery Technology Center,
¶ Department of Pharmacy, University of Helsinki, and
Protein Chemistry Unit, Institute of Biomedicine, University of
Helsinki, Helsinki, Finland
Received for publication, June 20, 2002, and in revised form, September 24, 2002
 |
ABSTRACT |
Eight human liver UDP-glucuronosyltransferases
(UGTs) were expressed in baculovirus-infected insect cells as fusion
proteins carrying a short C-terminal extension that ends with 6 histidine residues (His tag). The activity of recombinant
UGT1A1, UGT1A3, UGT1A4, UGT1A6, UGT2B4, UGT2B7, and UGT2B15 was
almost fully inhibited by 0.2% Triton X-100. In the case of UGT1A9,
however, glucuronidation of -naphthol and scopoletin was resistant
to such inhibition, whereas glucuronidation of entacapone and several
other aglycones was sensitive. His-tagged UGT1A9 was purified by
immobilized metal-chelating chromatography (IMAC). Purified UGT1A9
glucuronidated scopoletin at a high rate, whereas its glucuronidation
activity toward entacapone was low and largely dependent on
phospholipid addition. Recombinant UGT1A9 in which the His tag was
replaced by hemagglutinin antigenic peptide (HA tag) was also prepared.
Insect cells were co-infected with baculoviruses encoding both
HA-tagged and His-tagged UGT1A9. Membranes from the co-infected cells,
or a mixture of membranes from separately infected cells, were
subjected to detergent extraction and IMAC, and the resulting fractions
were analyzed for the presence of each type of UGT1A9 using
tag-specific antibodies. In the case of separate infection, the
HA-tagged UGT1A9 did not bind to the column. When co-infected with
His-tagged UGT1A9, however, part of the HA-tagged enzyme was bound to
the column and was eluted by imidazole concentration gradient together
with the His-tagged UGT1A9, suggesting the formation of stable dimers
that contain one His-tagged and one HA-tagged UGT1A9 monomers.
 |
INTRODUCTION |
UDP-glucuronosyltransferases
(UGTs)1 are a family of
membrane-bound proteins of the endoplasmic reticulum that play an
important role in the biotransformation of a large number of
xenobiotics and endogenous compounds (for reviews see Refs. 1-5). The
UGTs catalyze glucuronic acid transfer from UDP-glucuronic acid
(UDP-GA) to acceptor compounds, aglycones, that are mostly lipophilic
and rather small molecules. Glucuronidation renders the aglycone more water-soluble and facilitates its excretion from the body. Mutations that lead to low expression level or weak activity of UGT1A1 result in
poor bilirubin glucuronidation and subsequent development of Crigler-Najjar or Gilbert's Syndromes (6, 7). Mutations in UGT1A7
were suggested to increase the risk of colorectal cancer development
(8), whereas UGT1A9 was shown to play an important role in the
metabolism of certain carcinogenic amines (9). In addition to
xenobiotics, UGTs of the 2B subfamily glucuronidate steroid hormones
and bile salts, all of which may have important clinical implications.
Hence, gaining deeper insight into the detoxification of carcinogens
and metabolism of drugs and several endogenous compounds requires
better understanding of the structure and function of UGTs.
The human genome contains many UGT genes (including some pseudogenes),
most of which are grouped into two main subfamilies, UGT1A and UGT2B.
The proteins are made of two large domains, a variable N-terminal half
that is encoded by exon 1 of the respected genes, and a highly
conserved C-terminal half that is encoded by exons 2-5. Due to exon
sharing the C-terminal domain is identical in all the UGTs of the 1A
subfamily. The C-terminal halves of the UGT2B enzymes are almost, but
not fully, identical to each other, and they are also very similar to
that of the UGT1A enzymes. Because all the UGTs employ UDP-GA as the
sugar donor, the identity/similarity of the C-terminal half, as well as
some experimental evidence, suggests that this domain harbors the
UDP-GA-binding site (10, 11). The sugar acceptor specificity may thus
be determined primarily by the structure of the N-terminal half (12).
The aglycone specificity does vary among the individual UGTs, but large
overlaps among them in this respect are well documented
(e.g. Ref. 4 and references therein). Furthermore, each UGT
can glucuronidate more than one substrate, a promiscuity that may be
typical of detoxifying enzymes. Many UGTs are expressed in the liver,
and in combination with partial overlapping in substrate specificity
and substrate promiscuity, this means that the characterization of
individual UGT activities in the native membrane is a very difficult
task. The use of recombinant enzymes has thus become a common practice
in the field, particularly when testing which UGT isoform
glucuronidates a specific substrate of interest (e.g. Refs.
1, 4, 13-15).
The UGTs are bound to the endoplasmic reticulum membrane so that most
of their mass is located on the lumenal side of the membrane. A short
trans-membrane segment is present close to the C-terminal of these
50-60-kDa proteins, and the last 20-22 amino acids are exposed on the
cytoplasmic side of the membrane (2, 3). The single trans-membrane
segment is not, however, the only way by which the enzymes bind to the
membrane. Recombinant UGTs that carry a stop codon before the beginning
of the trans-membrane segment were reported still to be bound to the
membrane but to be catalytically inactive (16, 17). In contrast to the
latter inactivation, however, truncation of UGT2B1 downstream from the trans-membrane segment did not abolish enzyme activity, indicating that
the cytoplasmic "tail" is not essential for glucuronic acid transfer (16).
Questions about whether or not the UGTs exist as dimers, either homo-
or heterodimers, and what the implications of such arrangements might
be have often been raised (18-23). It was recently suggested that
heterodimers including the guinea pig enzymes UGT2B21 and UGT2B22 might
exhibit activity that is either weaker or even undetectable when either
of the two participating UGTs is expressed alone (22). On the other
hand, it was reported that UGT1A1 forms homodimers and not heterodimers
and that dimers that contain one native and one mutant monomer are
partly or completely inactive (23). Nevertheless, determination of the
oligomeric state of human UGTs, either recombinant or in the native
membrane, is not an easy task because of the absence of a good
purification procedure that would yield sufficient amount of the pure
and active enzyme. If an inactive enzyme turns out to be monomeric, it
may be claimed that monomerization during the purification was the
cause of activity loss; and if it is found to be oligomeric, then it
may be argued that the enzyme aggregated during purification.
We have prepared a battery of recombinant human liver UGTs that were
expressed as fusion proteins with a C-terminal His tag. Among these
UGTs, the activity of UGT1A9 is exceptional in its resistance to
inhibition by high concentration of several detergents, at least when
glucuronidation of some aglycones is concerned. In addition, our
results indicate that the recombinant human UGT1A9 is a stable
homodimeric enzyme.
 |
EXPERIMENTAL PROCEDURES |
Chemicals--
-Naphthol, 4-methylumbelliferone,
p-nitrophenol, saccharolactone, scopoletin, umbelliferone,
UDP-GA, -naphthyl- -D-glucuronide, 4-methylumbelliferyl- -D-glucuronide, and
p-nitrophenyl- -D-glucuronide were purchased
from Sigma, and 7-hydroxycoumarin glucuronide was from UFC.
Radiolabeled [14C]UDP-GA was from PerkinElmer Life
Sciences. Entacapone was kindly provided by Orion Pharma (Espoo,
Finland), and entacapone glucuronide was synthesized in our laboratory
(24). Triton X-100 was purchased from BDH; dodecyl maltoside was from
Anatrace, and phospholipids (phosphatidylcholine type X-E) were from Sigma.
Cloning and Expression--
The human UGTs 1A6 and 1A9 were
previously cloned and expressed in our laboratory (25). Complementary
DNAs corresponding to 1A1, 1A3, 1A4, 1A6, 1A9, 2B4, 2B7, and 2B15 were
amplified by reverse transcriptase-PCR using total liver RNA
(Invitrogen) as template, a Moloney murine leukemia virus-reverse
transcriptase (Sigma) for the first strand DNA synthesis, and either
Taq DNA polymerase (Fermentas), Vent DNA polymerase (New
England Biolabs), or Herculase blend (Stratagene) for the
amplification. Gene-specific oligonucleotides were used in each case
(sequences are available upon request). The amplified genes were
subcloned into a suitable vector, pGem-T-Easy (Promega) or pUC19, and
subjected to a second round of PCR, in which a BamHI site
was introduced a few nucleotides upstream from the translation
initiation point (the first ATG) and a SalI site immediately
upstream from the stop codon. The BamHI-SalI
fragment from each cloned UGT was then subcloned into pFastBac
derivatives (Fig. 1) containing a short linker encoding an enterokinase
cleavage site, 6 His residues, and a stop codon that were inserted into
the original plasmid (Invitrogen). The UGTs of the 1A family were
subcloned into pFBXHC and the members of the 2B family into pFBXHA. The
cloned genes were sequenced within this construct before the generation
of recombinant baculovirus. The latter was performed by transposition
within Escherichia coli DH10Bac cells, selection of correct
colonies, purification of bacmid DNA, and transformation of the SF9
insect cells using the Cellfectin reagent according to the
manufacturer's instructions (Invitrogen). For protein production the
cells were cultured in suspension in SF900 II medium that was
supplemented with 10% heat-inactivated fetal bovine serum. The optimal
infection size for each viral stock was determined by infecting several
5-ml cell suspensions (2 × 106 cells/ml) in 100-ml
flasks with different amounts of virus from a given stock, and by
assaying activity in the cells that were collected 45-48 h
post-infection. Protein production of the different recombinant UGTs
was normally initiated by infecting 40-60 ml of cell suspension in a
250-ml flask with the optimal amount of virus from the specific stock
and culturing at 27 °C for 45-48 h at 120 rpm. The cells were
collected by centrifugation and stored at 20 °C for up to 2 months.
Membrane Preparation--
Cells were thawed and suspended in
about 1 ml of washing buffer (25 mM Tris-HCl, pH 7.5, 0.5 mM EDTA) per 40 ml of original culture volume and
centrifuged for 5 min at 15,700 × g. The pellets were
suspended in cold H2O for osmotic lysis so that cells
originating from about 80 ml of initial culture volume were eventually
mixed with 80 ml of cold H2O. The suspension was stirred
for 10 min and centrifuged at 41,000 × g for 2 h.
Finally, if the membranes were designated for activity assays, the
pellets were suspended in a small amount of buffer, homogenized using a
glass Potter homogenizer, divided into aliquots, and stored at
70 °C until use. In case the membranes were designated for enzyme
purification, the pellets were suspended in salt-containing and
EDTA-free buffer (25 mM Tris-HCl, pH 7.5, 500 mM NaCl), centrifuged once more as described above, and
stored at 20 °C.
Activity Assays--
Assay mixtures contained 50 mM
phosphate buffer, pH 7.4, 10 mM MgCl2, 5 mM saccharolactone, 5 mM UDP-GA, 0.15-0.35
mg/ml protein of the membranes containing the appropriate recombinant
UGT, or 0.1 mg/ml pooled human liver microsomes (Gentest), and 500 µM aglycone substrate, unless stated otherwise
(e.g. Figs. 2 and 5). The detergent tolerance tests were
performed at concentrations above the critical micellar concentrations
depending on the detergent tested. The concentration of sonicated
phospholipids in assays of the purified UGT1A9, when added, was 1 mg/ml. All the UGT activity assays were performed at 37 °C and the
reaction time varied, within a linear range, from 15 to 60 min. The
reactions were terminated, and the proteins were precipitated by an
addition of cold perchloric acid to a final concentration of 365 mM and chilling in an ice bath for 10 min, followed by 5 min of centrifugation at 15,700 × g. Aliquots of the
supernatants were analyzed using model 1100 high pressure liquid
chromatography (Agilent) under the conditions described in Table
I.
Purification of UGT1A9--
All the steps were carried out on
ice or at 4 °C. Membranes were thawed and suspended in extraction
medium (25 mM Tris, pH 7.5, 500 mM NaCl, 1%
Triton X-100) at about 1-2 mg of protein/ml. The suspension was mixed
for 10 min and centrifuged at 41,000 × g for 1 h.
The resultant supernatant was filtered through a 0.45-µm syringe
filter to remove the remaining particles and loaded onto a
nickel-charged His Hi-trap column attached to an ÄKTA prime
machine (Amersham Biosciences) that has been pre-equilibrated with
Buffer A (25 mM Tris, pH 7.5, 500 mM NaCl,
0,05% Triton X-100, 50 mM imidazole). After extensive
washing the bound protein was eluted by imidazole gradient, 50-400
mM, in the presence of NaCl and Triton X-100. The collected
fractions were examined by SDS-PAGE and Western blotting, and selected
fractions were pooled and concentrated using Centriplus YM30 filter
device (Millipore).
Western Blotting--
Proteins were separated by 12% SDS-PAGE
(26) and transferred to PROTRAN 0.45-µm pore size nitrocellulose
transfer membrane (Schleicher & Schuell) in the Mini PROTEAN 3 apparatus (Bio-Rad). His-tagged recombinant UGTs were detected using
Tetra-His monoclonal antibodies (Qiagen) and HA-tagged UGT1A9 with the
HA.11 monoclonal antibodies (Covance). The second antibody was
horseradish peroxidase-conjugated goat anti-mouse IgG (Santa Cruz
Biotechnology). The SuperSignal West Pico chemiluminescent system
(Pierce) was employed for visualization.
Protein concentrations were measured using the bicinchoninic acid (BCA)
system (Pierce) and bovine serum albumin as a standard. N-terminal
sequencing was performed on an Applied Biosystems 477A/120A automated
sequencer, in the gas phase mode (27), following the procedure supplied
by the manufacturer.
 |
RESULTS |
Eight different human UGTs, 1A1, 1A3, 1A4, 1A6, 1A9, 2B4, 2B7, and
2B15 were cloned and expressed in baculovirus-infected insect cells as
His-tagged proteins. The recombinant enzymes also contain an
enterokinase cleavage site (Fig. 1), but
due to the good specific activity of the expressed UGTs, and the
usefulness of the His tag for immunodetection, enterokinase treatment
was omitted. The expression of the different UGTs was aimed at getting a high yield of the active enzyme rather than a high protein
production. To this end activity assays in the presence of suitable
substrates were used in order to optimize infection with each virus
stock and to develop the isolation protocol of the membranes. The
outcome of these experiments indicated that in most cases there is an optimal value for the infection size and that the post-infection culturing should be carried out for about 48 h. During the
experiments to improve sample preparation methods, we have observed
that sonication reduces total activity and that such a treatment to
disrupt insect cells that were cultured in suspension is unnecessary.
Freezing, thawing, and mild osmotic shock render the cells permeable
for both UDP-GA and the aglycone substrates. In line with these
observations a total membrane fraction, rather than microsomes, was
used for the subsequent activity assays.

View larger version (25K):
[in this window]
[in a new window]
|
Fig. 1.
Construction of plasmids for expression of
recombinant UGTs as fusion proteins with a C-terminal His tag. The
nucleotide sequence of the multicloning sites of the original pFastBac
and its two derivatives that were prepared and employed in this study,
pFBXHA and pFBXHC, are shown. Selected restriction enzyme sites are
depicted above the sequences. The amino acid sequences of
the C-terminal extensions, resulting from in frame ligation
into the SalI sites, are shown below the
nucleotide sequences.
|
|
It may be asked whether or not the recombinant UGTs function like their
counterparts in the native tissue, particularly when they are slightly
modified. Nevertheless, the overlap in substrate specificity among many
of the UGTs, and the expression of all the UGTs that are examined in
this work in the liver, renders comparison of the kinetic properties
between most recombinant and native UGTs very difficult. In the case of
UGT1A9, however, it is feasible to do such a comparison because
entacapone, a selective substrate for this enzyme, is poorly
glucuronidated by the other liver UGTs (28). We have thus analyzed the
rate of entacapone glucuronidation by human liver microsomes and the
recombinant UGT1A9 that carries the C-terminal extension (Fig.
2). The similarity in specific activity
between the two preparations is high, but this may partly be
coincidental. Nevertheless, it is clear that the two different samples
exhibit similar kinetics, including both the high affinity for
entacapone as well as the substrate inhibition at high concentrations
of the aglycone (Fig. 2). It can thus be concluded that the recombinant
His-tagged UGT1A9 that was expressed in baculovirus-infected SF9 cells
is a good model for the native enzyme.

View larger version (14K):
[in this window]
[in a new window]
|
Fig. 2.
Kinetics of entacapone glucuronidation by
membrane-bound recombinant UGT1A9 and human liver microsomes. The
UDP-GA concentration in these assays was 1 mM, and the
aglycone concentrations are shown on the abscissa. The
glucuronidation rates at low entacapone concentrations are shown on a
different scale in the inset.
|
|
The lack of a good method to purify individual UGTs in an active form
was singled out as the major current hurdle in understanding their
structure-function relationships (3). The recombinant UGTs described in
this study carry His tags that should allow fast purification by
immobilized metal affinity chromatography (IMAC) and are thus most
suitable for the purification experiments. Being membrane proteins,
purification of a UGT requires extraction by a detergent that does not
inactivate the enzyme at concentrations above the critical micellar
concentration (cmc) for the given detergent. We have tested the effects
of 0.2% Triton X-100 and 0.1% dodecyl maltoside on the activity of
recombinant UGTs. The effects of both detergents on the glucuronidation
of -naphthol and scopoletin by the different recombinant UGTs were
very similar, and the Triton X-100 results are presented in Table
II. In the case of both aglycones, UGT1A9
was the only enzyme that is not merely resistant to the
detergent-induced inhibition but even stimulated by such treatments.
Recombinant UGT1A4 was not tested in these experiments because it does
not glucuronidate scopoletin or -naphthol at measurable rates (not
shown). The glucuronidation of 4-aminobiphenyl by recombinant UGT1A4
was, however, almost fully inhibited by Triton X-100.
View this table:
[in this window]
[in a new window]
|
Table II
Effect of Triton X-100 (0.2%, w/v) on the activities of
different recombinant UGTs
The detergent was added to samples containing the respective
membrane-bound UGT just before the onset of the reaction.
|
|
The detergent effects in the inhibition experiments were rather rapid
(Tables II and III, and data in
the text below), because the detergents were added to the
reaction mixture that already contained membranes, and neither
preincubation nor centrifugation were performed before the initiation
of the enzymatic reactions by substrate addition. The aglycone
substrates selected for the initial experiments were -naphthol and
scopoletin because they allow a parallel examination of the different
UGTs. The results were somewhat surprising and similar for both the
substrates, i.e. UGT1A9 is the only enzyme that is not
severely inhibited by Triton X-100 (Table II). The observed
detergent-induced stimulation of UGT1A9 activity (Table II) can
probably be attributed to membrane disruption that makes previously
sealed vesicles fully permeable to UDP-GA. Not every detergent,
however, stimulates UGT1A9 activity. The glucuronidation activity of
-naphthol by the membrane-bound UGT1A9 in the presence of 1% (w/v)
CHAPS and sodium cholate was about 35 and less than 5%, respectively,
of the control rate (no added detergent), and the glucuronidation of
scopoletin was almost totally inhibited by 50 mM octyl
glucoside.
View this table:
[in this window]
[in a new window]
|
Table III
Effect of Triton X-100 (0.2%, w/v) on the glucuronidation
of different aglycones by recombinant UGT1A9
Detergent addition to samples containing membrane-bound UGT1A9 was done
just before the onset of the reaction. The inhibition by detergent
addition, where indicated, was almost total.
|
|
The finding that glucuronidation of scopoletin and -naphthol by
UGT1A9 is not inhibited by Triton X-100 (Table II) was initially believed to suggest that the resistance to detergent inhibition arises
solely from the protein structure. However, it soon turned out that
this resistance is also dependent on the properties of the aglycone,
because the glucuronidation of entacapone by recombinant UGT1A9 was
almost fully inhibited by Triton X-100 at a concentration that did not
inhibit the glucuronidation of scopoletin and -naphthol (not shown).
Following this observation we have tested the effect of 0.2% Triton
X-100 on the glucuronidation of several other aglycones by the
membrane-bound UGT1A9, and the results are summarized in Table III.
With the exception of -naphthol and scopoletin, we have thus
far not found any aglycone for which the glucuronidation is resistant
to detergent inhibition (Table III).
In order to find out whether the inhibition of the UGTs by Triton X-100
is reversible, we have incubated UGT1A6 in the presence of 0.2% Triton
X-100, in 50 mM phosphate buffer at pH 7.4 and 37 °C for
30 min. Following this incubation the enzyme was diluted severalfold in
a detergent-free buffer and was subjected to glucuronidation assay of
-naphthol. The results, presented in Fig.
3A as specific activity of the
diluted UGT1A6, demonstrate that the detergent inhibition is, at least
partly, reversible. The activity increased sharply once the
concentration of the remaining Triton X-100 fell below its cmc of about
0.02%, even though the detergent to protein ratio was exactly the same
in all the dilutions (Fig. 3). Recovery of the activity after such an
incubation was, however, incomplete and reached about 30% of the
activity of the control sample that was treated similarly but in the
absence of Triton X-100. Another experiment was conducted with UGT1A9,
in order to test the reversibility of the Triton X-100 inhibition on
glucuronidation activity of entacapone. In addition, we wanted to test
whether the high detergent concentration used in membrane extraction
step of UGT1A9 purification (see below) induces irreversible changes in
this enzyme. UGT1A9-containing membranes were thus incubated in the
presence of 1% Triton X-100, albeit at 0 rather than 37 °C, and
then diluted and assayed for glucuronidation rates of entacapone (Fig.
3B). The results clearly demonstrate that the high
Triton-induced inhibition of the entacapone glucuronidation activity by
UGT1A9 is reversible once the final detergent concentration drops below
0.02%. Furthermore, in contrast to the only partial recovery of
activity observed for UGT1A6, the rate of entacapone glucuronidation by
UGT1A9 at post-dilution detergent concentration of 0.01% (Fig.
3B) was as high as measured for the membrane-bound UGT1A9
that was never exposed to detergents.

View larger version (18K):
[in this window]
[in a new window]
|
Fig. 3.
The inhibition of UGT1A6 and UGT1A9 by
Triton X-100 is reversible. The indicated membrane-bound enzymes
were incubated in the presence of Triton X-100 for 30 min as follows:
UGT1A6, 3 mg/ml, 37 °C, 0.2% Triton X-100; UGT1A9, 2.4 mg/ml,
0 °C, 1% Triton X-100. The incubations were followed by dilution
with detergent-free buffer to different degrees, as shown on the
abscissa, and activity assays.
|
|
The resistance of UGT1A9 to detergent-induced inhibition, at least when
glucuronidation of scopoletin or -naphthol is concerned, selected
this isoform as an attractive candidate for purification. To this end
the insect cell membranes that carry recombinant UGT1A9 were washed
with high salt concentration in order to remove peripheral membrane
proteins and also to remove EDTA prior to IMAC purification. The
salt-washed membranes were solubilized using 1% Triton X-100, and the
extracted UGT1A9 was purified by a single step of affinity chromatography in the presence of the detergent. SDS-PAGE analyses indicate that such single-step purification yields a highly purified enzyme (Fig. 4).

View larger version (37K):
[in this window]
[in a new window]
|
Fig. 4.
SDS-PAGE analysis of affinity-purified
UGT1A9. One microgram of purified recombinant UGT1A9 was loaded on
the gel, and proteins were visualized using Coomassie Blue dye. The
sizes of the molecular mass markers, in kDa, are indicated on
the left.
|
|
The activity of the purified enzyme, and its dependence on added
phospholipids, was assayed in the presence of either scopoletin or
entacapone (Fig. 5). Glucuronidation of
scopoletin by the purified UGT1A9 was relatively high, and addition of
phospholipids increased it further by about 20% (Fig. 5A).
On the other hand, glucuronidation of entacapone by the
purified enzyme in the absence of added phospholipids was very low,
although measurable. Addition of sonicated phospholipids stimulated the
glucuronidation of entacapone by about 400%, but it was still much
lower than the glucuronidation of scopoletin by the same enzyme
preparation (Fig. 5B). It may be noted here that the
addition of sonicated phospholipids had no effect on the activity of
the membrane-bound enzyme (not shown) and that membrane-bound UGT1A9
glucuronidates entacapone, at an optimal substrate concentration, much
faster than it glucuronidates scopoletin (cf. data in Fig. 2
and Table II).

View larger version (17K):
[in this window]
[in a new window]
|
Fig. 5.
Stimulation of enzymatic activities of
purified UGT1A9 by added phospholipids. The scopoletin
(A) and entacapone (B) glucuronidation activities
were assayed either without added phospholipids (dark shade,
no addition), or in the presence of 1 mg/ml
phospholipids (light shade,
+phospholipids). The ordinate indicates
glucuronidation rates in both schemes, albeit at different
scales.
|
|
The mild effect of the added phospholipids on the glucuronidation rate
of scopoletin by the purified UGT1A9 might suggest that this activity
does not require a membrane-like environment. In order to understand
better this observation, we have examined the kinetics of scopoletin
glucuronidation by both the purified UGT1A9, in the presence of added
phospholipids, and membrane-bound enzyme (Fig.
6). The purification process increased
the apparent Km of UGT1A9 for scopoletin about 10 times, from 61 ± 18 µM in the membrane-bound enzyme
to 790 ± 69 µM in the purified UGT1A9 (Fig.
6A). The apparent Km for UDP-GA was also increased, from 229 ± 52 to 704 ± 47 µM (Fig.
6B), but in relative terms not as much as for the lipophilic
aglycone, scopoletin. In any case, the high specific activity of the
purified UGT1A9, about 500 times higher than the membrane-bound enzyme
under the assay conditions used in these experiments (Fig. 6),
indicates that it is a pure and active enzyme.

View larger version (21K):
[in this window]
[in a new window]
|
Fig. 6.
Kinetic analyses of membrane-bound and
affinity-purified UGT1A9. The assays were carried out either with
membrane-bound UGT1A9 at a protein concentration of 100 or 0.5 µg/ml
purified UGT1A9 that was supplemented with 1 mg/ml sonicated
phospholipids. The UDP-GA concentration was 2.5 mM
(A), and the scopoletin concentration was 2 mM
(B). Fitting to Michaelis-Menten equation was done using
SigmaPlot (enzyme kinetics module 1.1, see text for
Km values). Note that in both A and
B the reaction velocities on the ordinates are
nmol·mg 1·min 1 for purified UGT1A9 and
pmol·mg 1·min 1 for the membrane-bound
enzyme.
|
|
The UGTs are expressed as precursor proteins with an N-terminal signal
sequence, even though the necessity of this peptide for directing the
newly synthesized proteins to the endoplasmic reticulum was recently
questioned (17). In any case, the availability of purified recombinant
UGT1A9 (Fig. 4) allowed the determination of the exact cleavage point
of the signal peptide by N-terminal protein sequencing. Purified UGT1A9
was directly subjected to 8 cycles of automated Edman degradation, and
the resultant sequence was XKLLVVPM. Determination of the
very first amino acid in this sequence, the X, was hampered
by the presence of high background and noise in the first cycle. The
N-terminal sequence (first 40 amino acids) of the precursor UGT1A9
protein is
MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFT, and
the underlined segment matches the sequence obtained from the purified
recombinant enzyme. Hence, the signal peptide cleavage in UGT1A9 that
was expressed in insect cells occurs between Ala-25 and Gly-26,
exactly at the position predicted for eukaryotic cells by the SignalP
program (29), available at www.cbs.dtu.dk/services/SignalP/.
Purification of an active UGT1A9 allows us to ask whether the UGTs are
dimeric enzymes, as suggested previously (19, 22, 23). However,
determination of the molecular weight of a purified membrane enzyme,
e.g. by size exclusion chromatography, is often ambiguous
due to the contribution of bound detergent micelle(s), the amount of
which does not necessarily correlate with the number of monomers in the
complex. In order to circumvent this obstacle, we have developed a new
method to test whether the recombinant UGT1A9 is monomeric or
oligomeric. The main element of the new system is preparation of a
second version of the enzyme as a fusion protein that differs from the
one used for the IMAC purification by the absence of the His tag and
the presence of a new tag. The latter must fulfill two requirements, it
should not mediate protein binding to the column used for purification
of the His-tagged enzyme, and it should allow reliable identification
of the fusion protein, e.g. by immunodetection. The cells
would then be co-transfected with baculoviruses (or equivalent gene
delivery vehicles in other systems) encoding both the His-tagged and
the differently tagged enzyme in order to allow formation of mixed
oligomers in the membrane. The expressed recombinant proteins will be
extracted and subjected to IMAC purification, and the collected
fractions will be examined for the presence of either type of the
tagged protein, e.g. by Western blotting. Because this
purification is dependent on the presence of a His tag, it can be
assumed that when the fractions of purified enzyme that were eluted
from the column by high imidazole concentration include, in addition to
His-tagged enzyme, significant amounts of the differently tagged
enzyme, then the latter enzyme must be in strong and stable contact
with the His-tagged UGT1A9. Hence, such a result would be good evidence
that the enzyme is dimeric, although the possibility of higher degree
of oligomerization cannot be excluded.
The HA antigenic peptide was an attractive choice for the second type
of C-terminal tag because it contains no His residues at all, and good
monoclonal antibodies against it are available. A HA-tagged version of
UGT1A9 was thus prepared, and it was found that the membrane-bound
HA-tagged UGT1A9 is fully active and that the detergent-extracted
HA-tagged UGT1A9 does not bind to the column. Hence, the two types of
recombinant UGT1A9 that are required for such an experiment were ready.
Considering the possible products of a co-infection experiment, in case
UGT1A9 is indeed dimeric, one can anticipate three different types of
dimers, namely HA/HA-, His/His-, and His/HA-tagged enzymes. The latter
two kinds of dimers are expected to bind to the column and may compete
for the available nickel atoms on its surface. Taking into account that
the evidence for the presence of dimers would come primarily from the
detection of His/HA-mixed tag dimers, it was important to try and
maximize the formation of such mixed tag dimers, and minimize the
formation of His/His identical tag dimers. To this end co-infection of
the insect cells was carried out using 75% of the optimal amount of virus per cell for the HA-tagged UGT1A9 and 25% of the optimum for the
His-tagged UGT1A9 (see "Experimental Procedures" for details).
The co-infected cells were cultured, subjected to membrane isolation,
Triton X-100 extraction, and affinity purification exactly as was done
previously for His-tagged-only infections (e.g. the preparation shown in Fig. 4). Samples from different fractions of the
chromatography were subjected, in parallel, to similar SDS-PAGEs that
were followed by Western blotting using monoclonal antibodies against
either the HA tag or the His tag. The results (Fig.
7) show that only HA-tagged enzyme was
present in the unbound fraction and that fractions 8-14 contained both
His-tagged and HA-tagged UGT1A9 (Fig. 7). The enzyme in the latter
fractions was eluted by imidazole concentration gradient, and its
elution profile was practically identical to that of His-tagged-only
enzyme in our regular purification experiments (not shown). Small
amounts of HA-tagged UGT1A9 were also visible in some fractions that
apparently lack His-tagged UGT1A9 (Fig. 7). In fraction 2 this could be
assigned to traces of unbound enzyme (the tail of the large peak of
unbound proteins), whereas in fractions 5 and 17 it is probably the
beginning and the end of the major peak of purified UGT1A9. It may be
noted in this respect that the HA tag is much more immunogenic than the
His tag and that the anti-HA tag monoclonal antibodies used in this
study appear to be very efficient in detecting small amounts of the
HA-tagged UGT1A9. The latter also means that no quantitative conclusion
about the ratio between His/HA-mixed tagged dimers to His/His
identically tagged dimers in fractions 8-14 can be drawn from these
experiments (Fig. 7). Nevertheless, our results provide a new and
independent indication that recombinant UGT1A9 forms oligomers, most
probably dimers. These dimers should be considered homodimers and not
heterodimers, regardless of the difference in the C-terminal tag
between them, because both the monomers are UGT1A9.

View larger version (38K):
[in this window]
[in a new window]
|
Fig. 7.
Identification of both His-tagged and
HA-tagged UGT1A9 in the peak fractions after IMAC purification of the
enzyme from co-infected cells. Proteins from cells producing both
His-tagged and HA-tagged recombinant UGT1A9 were extracted by 1%
Triton X-100 and subjected to affinity purification by IMAC using a
nickel-containing column. Fractions were analyzed by Western blots for
the presence of either HA-tagged (A) or His-tagged
(B) UGT1A9, using tag-specific monoclonal antibodies (see
text and "Experimental Procedures" for further details). Equal
volumes of undiluted samples from the indicated fractions were loaded
on the two SDS-PAGES, except for the unbound sample that was diluted 10 times.
|
|
In order to verify that the apparent dimerization (Fig. 7) is not
caused by artifactual aggregation of the enzymes upon detergent extraction, we have carried out the following control experiment. Insect cells were infected with baculovirus encoding either His-tagged or HA-tagged UGT1A9, and the entire process of protein expression and
membrane isolation and washing was done separately for each batch. The
two membrane batches were later thawed and mixed together thoroughly,
and in the subsequent steps of Triton X-100 extraction and IMAC
purification they were treated as a single batch. The different
fractions after the purification were analyzed by Western blotting as
shown in Fig. 7, but the results were different. In the case of
separate infection, HA-tagged UGT1A9 was only detected in the unbound
fraction and not in the imidazole-eluted fractions. On the other hand,
the distribution of the His-tagged enzyme among the different fractions
of this control experiment was practically identical to the
distribution of this type of recombinant UGT1A9 in the case of
co-infected cells, i.e. as shown in Fig. 7B. It thus appears that the formation of HA/His tagged UGT1A9 dimers requires
the expression of both types of enzyme in the same cell. Such mixed tag
dimers are not induced by detergent solubilization or other conditions,
e.g. high salt concentration, to which the enzyme is exposed
during detergent extraction and IMAC purification.
 |
DISCUSSION |
Eight hepatic UGTs were cloned and expressed as active enzymes
using baculovirus-infected insect cells. The main difference between
the new recombinant UGTs and those that are commercially available is
the presence of a C-terminal His tag (Fig. 1). The His tags enable easy
purification of the UGTs by IMAC, regardless of whether or not they are
active. In addition, the His tags allow the use of monoclonal
antibodies against this peptide in order to follow expression, and it
could provide a way to compare the amount of recombinant enzymes in
different membrane preparations.
The addition of a short peptide to the C-terminal end of the UGTs might
be expected to affect enzymatic activity, like several mutations in
that region have done (16). However, a comparison of the
glucuronidation activity of entacapone by the recombinant UGT1A9 with
the native enzyme in human liver microsomes suggests that the former is
a very good model for the latter UGT (Fig. 2). Extension of this
conclusion to the other UGTs is currently hampered, however, by
overlapping substrate specificities and co-expression in the same
tissue. In any case, the positive results with UGT1A9 and the good
activities of the other recombinant UGTs (Table II) suggest that the
above conclusion may hold for the entire set of recombinant human
UGTs.
A good purification method for any UGT, and particularly for the human
enzymes, has been anticipated (e.g. Ref. 3). This work we
fulfills this expectation and also provides a possible explanation for
the previous failures to purify these enzymes in active states. UGTs
are membrane-bound enzymes, and they should be extracted from the
membrane using a detergent prior to the separation from the other
integral membrane proteins, e.g. by chromatography. It is
well known that low concentration of a detergent may activate UGTs in
liver microsomes (e.g. Ref. 30). In retrospect it seems that
the optimal concentrations found for these activations resulted from a
balance between making the membrane more permeable to UDP-GA on the one
hand, and a minimal enzyme inhibition on the other hand. In any case,
the optimal detergent concentrations in such assays were below the cmc
of the detergent and were thus insufficient for solubilization and
subsequent purification.
One of the first steps in developing a new purification procedure for
the recombinant UGTs was examining the effect of several detergents, at
concentrations above their respective cmcs, on the activities of the
different enzymes. Triton X-100 and dodecyl maltoside were examined
first, the former because it is relatively inexpensive and has been
used previously for UGT studies, and the latter because it is
considered to be highly suitable for the purification of fragile
membrane proteins. The initial results were somewhat surprising, and
partly disappointing, because all the UGTs, with the exception of 1A9,
were highly sensitive to both detergents (the effects of dodecyl
maltoside were very similar to those of Triton X-100 that are
summarized in Table II). It is not clear at this stage what makes the
UGTs sensitive to these detergents. However, the partial or full
recovery of activity by lowering the detergent concentration below its
cmc without changing the detergent to protein ratio (Fig. 3) indicates
that the effect of Triton X-100 is not an irreversible inactivation of
the UGTs.
An interesting and unexpected finding was the dependence of the
detergent inhibition on the type of aglycone substrate used (Table
III). In order to gain a better understanding about this phenomenon, we
have examined several aglycones that can be glucuronidated by
membrane-bound UGT1A9, and more of them will be tested in the future.
Thus far, however, we were not able to identify the factor(s) that
determine whether or not the glucuronidation of a given substrate will
be sensitive to inhibition by Triton X-100. In addition, it cannot be
ruled out that there are aglycone substrates the glucuronidation of
which by UGTs other than 1A9 may be resistant to detergent-induced
inhibition. In line with this, it may be noted that purification of
UGT1A9 would have never been attempted if umbelliferone or
4-methylumbelliferone were selected for the first detergent
solubilization trials instead of -naphthol and scopoletin (Tables II
and III).
The rate of entacapone glucuronidation by the purified UGT1A9 was low,
and it was stimulated significantly by the addition of sonicated
phospholipid (Fig. 5B). On the other hand, glucuronidation of scopoletin by the purified enzyme was only slightly increased by
such an addition (Fig. 5A). This
substrate-dependent difference in response to phospholipid
addition correlates well with the sensitivity of glucuronidation
activities of the different aglycones by the membrane-bound UGT1A9 to
inhibition by Triton X-100 (Table III). It may thus be suggested that
the inhibitory effect of the detergent may be partly caused by
delipidation of the protein. Nevertheless, the observed difference
between the membrane-bound and purified UGT1A9 in the apparent
Km for scopoletin, and to a less extent also to
UDP-GA, may indicate that complete reversal of the purification-induced
changes in this enzyme cannot be achieve merely by phospholipid
addition (Fig. 6). It remains to be studied if certain phospholipid
head groups, fatty acid chains, or other components of biological
membranes such as cholesterol could reconstitute the environment of the
enzyme and fully restore the apparent kinetic parameters of the enzyme.
The question whether the UGTs are dimeric and, if so, are they
homodimeric or heterodimeric have been examined and discussed in
previous studies (e.g. Refs. 19, 22, and 23). One of the
main reasons for the attempts to study the oligomeric state of the
recombinant UGT1A9 was the possibility that the mechanism of
detergent-induced inhibition of most UGTs (Table II) is the monomerization of dimeric enzymes. Studying whether a given enzyme is
dimeric requires the availability of an active preparation in order to
avoid artifactual results, and this could not be guaranteed for the
UGTs, because the activities of them are inhibited by the detergents we
have tested so far. UGT1A9 was different in this respect, because its
enzyme activity toward some substrates is sensitive to Triton X-100
inhibition, whereas toward other substrates it is not (Table III). We
have used differently tagged recombinant UGTs to study dimerization of
UGT1A9, and the results suggest that it forms dimers, if not larger
oligomers, when expressed in baculovirus-infected insect cells (Fig.
7). The interaction between the two monomers in dimeric UGT1A9 appears
to be tight and stable, and they are not easily dissociated from each
other under the conditions used for extraction from the membrane and affinity purification. In light of the present findings and previous reports (19, 22, 23), it may be suggested that dimer formation is
indeed a property of many UGTs, and might be essential for UGTs
activity. Nevertheless, detergent inhibition is not mediated by
monomerization, at least as far as the entacapone glucuronidation activity of UGT1A9 is concerned.
Finally, the results and methods described in this paper open new
avenues for detailed structural and functional studies of UGTs. In
addition, this study raises new questions, particularly about the
factors affecting the interactions of UGTs with detergents, and how
this may lead to discrimination between certain aglycones. Extending
the lines of research presented here and the development of new
approaches to solve these questions are likely to significantly increase our understanding about this family of important enzymes.
 |
ACKNOWLEDGEMENTS |
We thank Jaana Tolmunen, Juanita
Korsström, and Sanna Sistonen for technical assistance.
 |
FOOTNOTES |
*
This work was supported by the National Technology Agency
(TEKES), Finland.The costs of publication of this
article were defrayed in part by the
payment of page charges. The article
must therefore be hereby marked
"advertisement" in
accordance with 18 U.S.C. Section
1734 solely to indicate this fact.
§
Present address: Dept. of Pharmacology and Toxicology, University
of Kuopio, P. O. Box 1627, 70210 Kuopio, Finland.
**
To whom correspondence should be addressed: Viikki DDTC, Dept. of
Pharmacy, P. O. Box 56 (Viikinkaari 5E), 00014 University of Helsinki,
Helsinki, Finland. Tel.: 358-9-191-59193; Fax: 358-9-191-59556; E-mail:
moshe.finel@helsinki.fi.
Published, JBC Papers in Press, November 14, 2002, DOI 10.1074/jbc.M206136200
 |
ABBREVIATIONS |
The abbreviations used are:
UGTs, UDP-glucuronosyltransferases;
cmc, critical micellar concentration;
HA, hemagglutinin antigenic peptide;
IMAC, immobilized metal-chelating
chromatography;
UDP-GA, UDP-glucuronic acid;
CHAPS, 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic
acid.
 |
REFERENCES |
| 1.
|
Burchell, B.,
Brierley, C. H.,
and Rance, D.
(1995)
Life Sci.
57,
1819-1831[CrossRef][Medline]
[Order article via Infotrieve]
|
| 2.
|
Meech, R.,
and Mackenzie, P. I.
(1997)
Clin. Exp. Pharmacol. Physiol.
24,
907-915[Medline]
[Order article via Infotrieve]
|
| 3.
|
Radominska-Pandya, A.,
Czernik, P. J.,
Little, J. M.,
Battaglia, E.,
and Mackenzie, P. I.
(1999)
Drug Metab. Rev.
31,
817-899[CrossRef][Medline]
[Order article via Infotrieve]
|
| 4.
|
Tukey, R. H.,
and Strassburg, C. P.
(2000)
Annu. Rev. Pharmacol. Toxicol.
40,
581-616[CrossRef][Medline]
[Order article via Infotrieve]
|
| 5.
|
King, C. D.,
Rios, G. R.,
Green, M. D.,
and Tephly, T. R.
(2000)
Curr. Drug Metab.
1,
143-161[CrossRef][Medline]
[Order article via Infotrieve]
|
| 6.
|
Kadakol, A.,
Ghosh, S. S.,
Sappal, B. S.,
Sharma, G.,
Chowdhury, J. R.,
and Chowdhury, N. R.
(2000)
Hum. Mutat.
16,
297-306[CrossRef][Medline]
[Order article via Infotrieve]
|
| 7.
|
Burchell, B.,
Soars, M.,
Monaghan, G.,
Cassidy, A.,
Smith, D.,
and Ethell, B.
(2000)
Toxicol. Lett.
113,
333-340[CrossRef]
|
| 8.
|
Strassburg, C. P.,
Vogel, A.,
Kneip, S.,
Tukey, R. H.,
and Manns, M. P.
(2002)
Gut
50,
851-856[Abstract/Free Full Text]
|
| 9.
|
Yueh, M.-F.,
Nguyen, N.,
Famourzadeh, M.,
Strassburg, C. P.,
Oda, Y.,
Guengerich, F. P.,
and Tukey, R. H.
(2001)
Carcinogenesis
22,
943-950[Abstract/Free Full Text]
|
| 10.
|
Pillot, T.,
Ouzzine, M.,
Fournel-Gigleux, S.,
Lafaurie, C.,
Tebbi, D.,
Treat, S.,
Radominska, A.,
Lester, R.,
Siest, G.,
and Magdalou, J.
(1993)
Biochem. Biophys. Res. Commun.
197,
785-791[CrossRef][Medline]
[Order article via Infotrieve]
|
| 11.
|
Battaglia, E.,
Terrier, N.,
Mizeracka, M.,
Senay, C.,
Magdalou, J.,
Fournel-Gigleux, S.,
and Radominska-Pandya, A.
(1998)
Drug Metab. Dispos.
26,
812-817[Abstract/Free Full Text]
|
| 12.
|
Mackenzie, P. I.
(1990)
J. Biol. Chem.
265,
3432-3435[Abstract/Free Full Text]
|
| 13.
|
Nguyen, N.,
and Tukey, R. H.
(1997)
Drug Metab. Dispos.
25,
745-749[Abstract/Free Full Text]
|
| 14.
|
Guengerich, F. P.,
Parikh, A.,
Johnson, E. F.,
Richardson, T. H.,
von Wachenfeldt, C.,
Cosme, J.,
Jung, F.,
Strassburg, C. P.,
Manns, M. P.,
Tukey, R. H.,
Pritchard, M.,
Fournel-Gigleux, S.,
and Burchell, B.
(1997)
Drug Metab. Dispos.
25,
1234-1241[Abstract/Free Full Text]
|
| 15.
|
Ethell, B. T.,
Beaumont, K.,
Rance, D. J.,
and Burchell, B.
(2001)
Drug Metab. Dispos.
29,
48-53[Abstract/Free Full Text]
|
| 16.
|
Meech, R.,
and Mackenzie, P. I.
(1998)
Arch. Biochem. Biophys.
356,
77-85[CrossRef][Medline]
[Order article via Infotrieve]
|
| 17.
|
Ouzzine, M.,
Magdalou, J.,
Burchell, B.,
and Fournel-Gigleux, S.
(1999)
J. Biol. Chem.
274,
31401-31409[Abstract/Free Full Text]
|
| 18.
|
Koiwai, O.,
Aono, S.,
Adachi, Y.,
Kamisako, T.,
Yasui, Y.,
Nishizawa, M.,
and Sato, H.
(1996)
Hum. Mol. Genet.
5,
645-647[Abstract/Free Full Text]
|
| 19.
|
Meech, R.,
and Mackenzie, P. I.
(1997)
J. Biol. Chem.
272,
26913-26917[Abstract/Free Full Text]
|
| 20.
|
Ikushiro, S.-I.,
Emi, Y.,
and Iyanagi, T.
(1997)
Biochemistry
36,
7154-7161[CrossRef][Medline]
[Order article via Infotrieve]
|
| 21.
|
Gueraud, F.,
and Paris, A.
(1998)
Gen. Pharmacol.
31,
683-688[Medline]
[Order article via Infotrieve]
|
| 22.
|
Ishii, Y.,
Miyoshi, A.,
Watanabe, R.,
Tsuruda, K.,
Tsuda, M.,
Yamaguchi-Nagamatsu, Y.,
Yoshisue, K.,
Tanaka, M.,
Maji, D.,
Ohgiya, S.,
and Oguri, K.
(2001)
Mol. Pharmacol.
60,
1040-1048[Abstract/Free Full Text]
|
| 23.
|
Ghosh, S. S.,
Sappal, B. S.,
Kalpana, G. V.,
Lee, S. W.,
Chowdhury, J. R.,
and Chowdhury, N. R.
(2001)
J. Biol. Chem.
276,
42108-42115[Abstract/Free Full Text]
|
| 24.
|
Luukkanen, L.,
Kilpelainen, I.,
Kangas, H.,
Ottoila, P.,
Elovaara, E.,
and Taskinen, J.
(1999)
Bioconjugate Chem.
10,
150-154[CrossRef][Medline]
[Order article via Infotrieve]
|
| 25.
|
Forsman, T.,
Lautala, P.,
Lundström, K.,
Monastyrskaia, K.,
Ouzzine, M.,
Burchell, B.,
Taskinen, J.,
and Ulmanen, I.
(2000)
Life Sci.
67,
2473-2484[CrossRef][Medline]
[Order article via Infotrieve]
|
| 26.
|
Laemmli, U. K.
(1970)
Nature
227,
680-685[CrossRef][Medline]
[Order article via Infotrieve]
|
| 27.
|
Baumann, M.
(1990)
Anal. Biochem.
190,
198-208[CrossRef][Medline]
[Order article via Infotrieve]
|
| 28.
|
Lautala, P.,
Ethell, B. T.,
Taskinen, J.,
and Burchell, B.
(2000)
Drug Metab. Dispos.
28,
1385-1389[Abstract/Free Full Text]
|
| 29.
|
Nielsen, H.,
Engelbrecht, J.,
Brunak, S.,
and von Heijne, G.
(1997)
Protein Eng.
10,
1-6[Abstract/Free Full Text]
|
| 30.
|
Luukkanen, L.,
Elovaara, E.,
Lautala, P.,
Taskinen, J.,
and Vainio, H.
(1997)
Pharmacol. Toxicol.
80,
152-158[Medline]
[Order article via Infotrieve]
|
| 31.
|
Kaivosaari, S.,
Salonen, J. S.,
Mortensen, J.,
and Taskinen, J.
(2001)
Anal. Biochem.
292,
178-187[CrossRef][Medline]
[Order article via Infotrieve]
|
Copyright © 2003 by The American Society for Biochemistry and Molecular Biology, Inc.

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
This article has been cited by other articles:

|
 |

|
 |
 
A. Mazur, C. F. Lichti, P. L. Prather, A. K. Zielinska, S. M. Bratton, A. Gallus-Zawada, M. Finel, G. P. Miller, A. Radominska-Pandya, and J. H. Moran
Characterization of Human Hepatic and Extrahepatic UDP-Glucuronosyltransferase Enzymes Involved in the Metabolism of Classic Cannabinoids
Drug Metab. Dispos.,
July 1, 2009;
37(7):
1496 - 1504.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Itaaho, M. H. Court, P. Uutela, R. Kostiainen, A. Radominska-Pandya, and M. Finel
Dopamine Is a Low-Affinity and High-Specificity Substrate for the Human UDP-Glucuronosyltransferase 1A10
Drug Metab. Dispos.,
April 1, 2009;
37(4):
768 - 775.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Siissalo, H. Zhang, E. Stilgenbauer, A. M. Kaukonen, J. Hirvonen, and M. Finel
The Expression of Most UDP-Glucuronosyltransferases (UGTs) Is Increased Significantly during Caco-2 Cell Differentiation, whereas UGT1A6 Is Highly Expressed Also in Undifferentiated Cells
Drug Metab. Dispos.,
November 1, 2008;
36(11):
2331 - 2336.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
K. Itaaho, P. I. Mackenzie, S.-i. Ikushiro, J. O. Miners, and M. Finel
The Configuration of the 17-Hydroxy Group Variably Influences the Glucuronidation of {beta}-Estradiol and Epiestradiol by Human UDP-Glucuronosyltransferases
Drug Metab. Dispos.,
November 1, 2008;
36(11):
2307 - 2315.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
G. P. Miller, C. F. Lichti, A. K. Zielinska, A. Mazur, S. M. Bratton, A. Gallus-Zawada, M. Finel, J. H. Moran, and A. Radominska-Pandya
Identification of Hydroxywarfarin Binding Site in Human UDP Glucuronosyltransferase 1A10: Phenylalanine90 Is Crucial for the Glucuronidation of 6- and 7-Hydroxywarfarin but Not 8-Hydroxywarfarin
Drug Metab. Dispos.,
November 1, 2008;
36(11):
2211 - 2218.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. Guo, A. Liu, H. Cao, Y. Luo, J. M. Pezzuto, and R. B. van Breemen
Biotransformation of the Chemopreventive Agent 2',4',4-Trihydroxychalcone (Isoliquiritigenin) by UDP-Glucuronosyltransferases
Drug Metab. Dispos.,
October 1, 2008;
36(10):
2104 - 2112.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
V. Uchaipichat, A. Galetin, J. B. Houston, P. I. Mackenzie, J. A. Williams, and J. O. Miners
Kinetic Modeling of the Interactions between 4-Methylumbelliferone, 1-Naphthol, and Zidovudine Glucuronidation by UDP-Glucuronosyltransferase 2B7 (UGT2B7) Provides Evidence for Multiple Substrate Binding and Effector Sites
Mol. Pharmacol.,
October 1, 2008;
74(4):
1152 - 1162.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A.-S. Patana, M. Kurkela, M. Finel, and A. Goldman
Mutation analysis in UGT1A9 suggests a relationship between substrate and catalytic residues in UDP-glucuronosyltransferases
Protein Eng. Des. Sel.,
September 1, 2008;
21(9):
537 - 543.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Kaivosaari, P. Toivonen, O. Aitio, J. Sipila, M. Koskinen, J. S. Salonen, and M. Finel
Regio- and Stereospecific N-Glucuronidation of Medetomidine: The Differences between UDP Glucuronosyltransferase (UGT) 1A4 and UGT2B10 Account for the Complex Kinetics of Human Liver Microsomes
Drug Metab. Dispos.,
August 1, 2008;
36(8):
1529 - 1537.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Y. Xiong, A.-S. Patana, M. J. Miley, A. K. Zielinska, S. M. Bratton, G. P. Miller, A. Goldman, M. Finel, M. R. Redinbo, and A. Radominska-Pandya
The First Aspartic Acid of the DQxD Motif for Human UDP-Glucuronosyltransferase 1A10 Interacts with UDP-Glucuronic Acid during Catalysis
Drug Metab. Dispos.,
March 1, 2008;
36(3):
517 - 522.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Zielinska, C. F. Lichti, S. Bratton, N. C. Mitchell, A. Gallus-Zawada, V.-H. Le, M. Finel, G. P. Miller, A. Radominska-Pandya, and J. H. Moran
Glucuronidation of Monohydroxylated Warfarin Metabolites by Human Liver Microsomes and Human Recombinant UDP-Glucuronosyltransferases
J. Pharmacol. Exp. Ther.,
January 1, 2008;
324(1):
139 - 148.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. Fujiwara, M. Nakajima, H. Yamanaka, M. Katoh, and T. Yokoi
Interactions between Human UGT1A1, UGT1A4, and UGT1A6 Affect Their Enzymatic Activities
Drug Metab. Dispos.,
October 1, 2007;
35(10):
1781 - 1787.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Nakajima, H. Yamanaka, R. Fujiwara, M. Katoh, and T. Yokoi
Stereoselective Glucuronidation of 5-(4'-Hydroxyphenyl)-5-phenylhydantoin by Human UDP-Glucuronosyltransferase (UGT) 1A1, UGT1A9, and UGT2B15: Effects of UGT-UGT Interactions
Drug Metab. Dispos.,
September 1, 2007;
35(9):
1679 - 1686.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Kaivosaari, P. Toivonen, L. M. Hesse, M. Koskinen, M. H. Court, and M. Finel
Nicotine Glucuronidation and the Human UDP-Glucuronosyltransferase UGT2B10
Mol. Pharmacol.,
September 1, 2007;
72(3):
761 - 768.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A.-S. Patana, M. Kurkela, A. Goldman, and M. Finel
The Human UDP-Glucuronosyltransferase: Identification of Key Residues within the Nucleotide-Sugar Binding Site
Mol. Pharmacol.,
September 1, 2007;
72(3):
604 - 611.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
R. Fujiwara, M. Nakajima, H. Yamanaka, A. Nakamura, M. Katoh, S.-i. Ikushiro, T. Sakaki, and T. Yokoi
Effects of Coexpression of UGT1A9 on Enzymatic Activities of Human UGT1A Isoforms
Drug Metab. Dispos.,
May 1, 2007;
35(5):
747 - 757.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. N. Operana and R. H. Tukey
Oligomerization of the UDP-glucuronosyltransferase 1A Proteins: HOMO- AND HETERODIMERIZATION ANALYSIS BY FLUORESCENCE RESONANCE ENERGY TRANSFER AND CO-IMMUNOPRECIPITATION
J. Biol. Chem.,
February 16, 2007;
282(7):
4821 - 4829.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Sten, S. Qvisen, P. Uutela, L. Luukkanen, R. Kostiainen, and M. Finel
Prominent but Reverse Stereoselectivity in Propranolol Glucuronidation by Human UDP-Glucuronosyltransferases 1A9 and 1A10
Drug Metab. Dispos.,
September 1, 2006;
34(9):
1488 - 1494.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Murai, N. Samata, H. Iwabuchi, and T. Ikeda
HUMAN UDP-GLUCURONOSYLTRANSFERASE, UGT1A8, GLUCURONIDATES DIHYDROTESTOSTERONE TO A MONOGLUCURONIDE AND FURTHER TO A STRUCTURALLY NOVEL DIGLUCURONIDE
Drug Metab. Dispos.,
July 1, 2006;
34(7):
1102 - 1108.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Finel, X. Li, D. Gardner-Stephen, S. Bratton, P. I. Mackenzie, and A. Radominska-Pandya
Human UDP-Glucuronosyltransferase 1A5: Identification, Expression, and Activity
J. Pharmacol. Exp. Ther.,
December 1, 2005;
315(3):
1143 - 1149.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
L. Luukkanen, J. Taskinen, M. Kurkela, R. Kostiainen, J. Hirvonen, and M. Finel
KINETIC CHARACTERIZATION OF THE 1A SUBFAMILY OF RECOMBINANT HUMAN UDP-GLUCURONOSYLTRANSFERASES
Drug Metab. Dispos.,
July 1, 2005;
33(7):
1017 - 1026.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Di Marco, M. D'Antoni, S. Attaccalite, P. Carotenuto, and R. Laufer
DETERMINATION OF DRUG GLUCURONIDATION AND UDP-GLUCURONOSYLTRANSFERASE SELECTIVITY USING A 96-WELL RADIOMETRIC ASSAY
Drug Metab. Dispos.,
June 1, 2005;
33(6):
812 - 819.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
A. Alonen, O. Aitio, K. Hakala, L. Luukkanen, M. Finel, and R. Kostiainen
BIOSYNTHESIS OF DOBUTAMINE MONOGLUCURONIDES AND GLUCURONIDATION OF DOBUTAMINE BY RECOMBINANT HUMAN UDP-GLUCURONOSYLTRANSFERASES
Drug Metab. Dispos.,
May 1, 2005;
33(5):
657 - 663.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. Smith, T. E. Meyerrose, T. Kohler, M. Namdar-Attar, N. Bab, O. Lahat, T. Noh, J. Li, M. W. Karaman, J. G. Hacia, et al.
Leaky ribosomal scanning in mammalian genomes: significance of histone H4 alternative translation in vivo
Nucleic Acids Res.,
March 1, 2005;
33(4):
1298 - 1308.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
S. Takeda, Y. Ishii, M. Iwanaga, P. I. Mackenzie, K. Nagata, Y. Yamazoe, K. Oguri, and H. Yamada
Modulation of UDP-Glucuronosyltransferase Function by Cytochrome P450: Evidence for the Alteration of UGT2B7-Catalyzed Glucuronidation of Morphine by CYP3A4
Mol. Pharmacol.,
March 1, 2005;
67(3):
665 - 672.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
Y. Ishii, A. Miyoshi, D. Maji, H. Yamada, and K. Oguri
SIMULTANEOUS EXPRESSION OF GUINEA PIG UDP-GLUCURONOSYLTRANSFERASE 2B21 (UGT2B21) AND 2B22 IN COS-7 CELLS ENHANCES UGT2B21-CATALYZED CHLORAMPHENICOL GLUCURONIDATION
Drug Metab. Dispos.,
October 1, 2004;
32(10):
1057 - 1060.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
J. M. Little, M. Kurkela, J. Sonka, S. Jantti, R. Ketola, S. Bratton, M. Finel, and A. Radominska-Pandya
Glucuronidation of oxidized fatty acids and prostaglandins B1 and E2 by human hepatic and recombinant UDP-glucuronosyltransferases
J. Lipid Res.,
September 1, 2004;
45(9):
1694 - 1703.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
E. Hazai, P. V. Gagne, and D. Kupfer
GLUCURONIDATION OF THE OXIDATIVE CYTOCHROME P450-MEDIATED PHENOLIC METABOLITES OF THE ENDOCRINE DISRUPTOR PESTICIDE: METHOXYCHLOR BY HUMAN HEPATIC UDP-GLUCURONOSYL TRANSFERASES
Drug Metab. Dispos.,
July 1, 2004;
32(7):
742 - 751.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
V. Uchaipichat, P. I. Mackenzie, X.-H. Guo, D. Gardner-Stephen, A. Galetin, J. B. Houston, and J. O. Miners
HUMAN UDP-GLUCURONOSYLTRANSFERASES: ISOFORM SELECTIVITY AND KINETICS OF 4-METHYLUMBELLIFERONE AND 1-NAPHTHOL GLUCURONIDATION, EFFECTS OF ORGANIC SOLVENTS, AND INHIBITION BY DICLOFENAC AND PROBENECID
Drug Metab. Dispos.,
April 1, 2004;
32(4):
413 - 423.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
M. Kurkela, S. Morsky, J. Hirvonen, R. Kostiainen, and M. Finel
An Active and Water-Soluble Truncation Mutant of the Human UDP-Glucuronosyltransferase 1A9
Mol. Pharmacol.,
April 1, 2004;
65(4):
826 - 831.
[Abstract]
[Full Text]
|
 |
|

|
 |

|
 |
 
L. Villeneuve, H. Girard, L.-C. Fortier, J.-F. Gagne, and C. Guillemette
Novel Functional Polymorphisms in the UGT1A7 and UGT1A9 Glucuronidating Enzymes in Caucasian and African-American Subjects and Their Impact on the Metabolism of 7-Ethyl-10-hydroxycamptothecin and Flavopiridol Anticancer Drugs
J. Pharmacol. Exp. Ther.,
October 1, 2003;
307(1):
117 - 128.
[Abstract]
[Full Text]
[PDF]
|
 |
|

|
 |

|
 |
 
T. Kuuranne, M. Kurkela, M. Thevis, W. Schanzer, M. Finel, and R. Kostiainen
GLUCURONIDATION OF ANABOLIC ANDROGENIC STEROIDS BY RECOMBINANT HUMAN UDP-GLUCURONOSYLTRANSFERASES
Drug Metab. Dispos.,
September 1, 2003;
31(9):
1117 - 1124.
[Abstract]
[Full Text]
[PDF]
|
 |
|
Copyright © 2003 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|