JBC Anatrace, Inc.

HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Originally published In Press as doi:10.1074/jbc.M406984200 on August 4, 2004

J. Biol. Chem., Vol. 279, Issue 41, 42945-42953, October 8, 2004
This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow All Versions of this Article:
279/41/42945    most recent
M406984200v1
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Ingham, K. C.
Right arrow Articles by McGavin, M. J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Ingham, K. C.
Right arrow Articles by McGavin, M. J.
Social Bookmarking
 Add to CiteULike   Add to Complore   Add to Connotea   Add to Del.icio.us   Add to Digg   Add to Reddit   Add to Technorati  
What's this?

Interaction of Staphylococcus aureus Fibronectin-binding Protein with Fibronectin

AFFINITY, STOICHIOMETRY, AND MODULAR REQUIREMENTS*

Kenneth C. Ingham{ddagger}, Shelesa Brew{ddagger}, Dareyl Vaz§, Daniel N. Sauder||, and Martin J. McGavin§**

From the {ddagger}Department of Biochemistry, American Red Cross Holland Laboratory, Rockville, Maryland 20855, ||Department of Dermatology, The Johns Hopkins University, Baltimore, Maryland 21287-0900, and §Department of Laboratory Medicine and Pathobiology, University of Toronto and Department of Microbiology, Sunnybrook and Women's College Health Science Centre, 2075 Bayview Avenue, Toronto, Ontario M4N 3M5, Canada

Received for publication, June 22, 2004


    ABSTRACT
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
The repetitive D1, D2, and D3 elements of Staphylococcus aureus fibronectin-binding protein FnBPA each bind the N-terminal 29-kDa fragment (N29) of fibronectin with low micromolar dissociation constants (Kd), but in tandem they compose a high affinity domain, D1–3. An additional seven Fn-binding segments have been predicted in FnBPA in a region N-terminal of the D-repeats (Schwarz-Linek, U., Werner, J. M., Pickford, A. R., Gurusiddappa, S., Kim, J. H., Pilka, E. S., Briggs, J. A., Gough, T. S., Höök, M., Campbell, I. D., and Potts, J. R. (2003) Nature 423, 177–181). We have evaluated the requirements for high affinity binding of N29 to the D-repeat domain and determined the affinity and stoichiometry of N29 binding to segments that are N-terminal of the D-repeats in the related FnBPB adhesin. We confirmed that D1–3 has two equivalent high affinity sites (Kd, ~1 nM) and provided evidence for one or more lower affinity sites (Kd, ~0.5 µM). Bimodular D1–2 and D2–3 exhibit intermediate affinity sites with respective Kd values of 0.25 and 0.044 µM, as well as a low affinity site with a Kd value of 2.2–2.5 µM. We also identified two binding domains that are N-terminal of the D-repeats, designated DuB and DuA. Segments internal to these domains individually bound N29 with similar Kd values of ~2 µM, whereas the DuBA polypeptide possessing both segments and other intervening sites bound four molecules of N29 with much higher affinity (Kd, ~10 nM). DuBAD, a larger polypeptide harboring all of the known or predicted binding motifs in FnBPB, bound seven to eight molecules of N29, with a Kd of ~7 nM. Because most of the isolated binding segments display low affinity for N29 and lack motifs for binding of one or both of the 1F1 and 5F1 modules in the N-terminal domain of Fn, we propose that high affinity is achieved in part as a consequence of self-interaction between bound molecules of N29.


    INTRODUCTION
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Staphylococcus aureus is the leading overall cause of nosocomial infections and is able to infect virtually every tissue and organ system of the body (1, 2). The increasing incidence of multiply antibiotic-resistant S. aureus strains and the emergence of vancomycin-resistant, multiply antibiotic-resistant S. aureus (3) have placed renewed interest on alternative means of prevention and control of infection. In this regard, members of the microbial surface components recognizing adhesive matrix molecules (MSCRAMM)1 family of adhesion proteins have come under intensive scrutiny due to their ability to promote adhesion to the extracellular matrix that surrounds and anchors cells in tissue (4, 5), thus representing attractive targets for therapeutic and vaccination strategies aimed at interfering with colonization. The fibronectin-binding proteins FnBPA and FnBPB are archetypal members of the MSCRAMM family and are encoded by tandem genes fnbA and fnbB (6, 7).

As exemplified by FnBPA, members of the MSCRAMM family display a modular architecture (Fig. 1A). Following the traditional domain nomenclature first used to describe FnBPA (7), the N terminus is a region of ~500 amino acids designated the A domain, which is followed by the B-region composed of two 30-amino acid repeats, a short spacer designated C, and then the D-repeat domain composed of three complete 37- or 38-amino acid repeats and part of a fourth repeat. The C terminus of FnBPA and other MSCRAMMs is dedicated to anchoring the proteins within the peptidoglycan layer of the Gram-positive cell wall. Initial studies established that the D-repeat domain of FnBPA engaged a 29-kDa N-terminal domain (N29) of Fn, with an affinity in the low nanomolar range (7). We subsequently found that the individual D1 and D2 repeats each bound N29 with Kd values of {approx}11–14 µM, compared with a Kd of {approx}2 µM for the D3 repeat, and a recombinant polypeptide possessing the three D-repeats in tandem (D1–3) displayed a high affinity of 1.5 nM (8). Whereas this suggested that the three tandem D-repeats were required to form a structure that is favorable for high affinity ligand binding, circular dichroism analyses indicated that the D1–3 domain was primarily unstructured in solution, acquiring extensive {beta} structure only when bound to N29 (9).



View larger version (58K):
[in this window]
[in a new window]
 
FIG. 1.
Scale diagram of FnBPA (A) and FnBPB (B) proteins and amino acid sequence of the DuBA polypeptide derived from the FnBPB adhesin (C) that is characterized in this study. The domain architecture of FnBPA is labeled according to traditional nomenclature (7), with PRR and CWA indicating C-terminal proline-rich repeats and cell wall anchor domains. The solid lines underneath each diagram approximate the span of different polypeptides encoded by phagemid clones that were recovered after screening of the phage-display library with biotinylated Fn, and dashed lines indicate clones recovered by selection on keratinocyte ECM. Parentheses after each segment indicate the number of times each sequence was recovered, followed by the numbering of the N- and C-terminal amino acids of each segment, within the mature FnBP adhesins. Expansion of the DuA segment in A shows the amino acid sequence of this clone and its homology to the R-motifs from the SfbI/PrtF adhesins of S. pyogenes. An amino acid sequence within DuA that corresponds precisely to predicted Fn-binding segment 5 of the FnBPA adhesin (16) is underlined. Within the amino acid sequence of the DuB clone shown in B, the shaded amino acids at the N- and C termini indicate residues that were deleted in construction of GST-DuB{Delta}N and DuB{Delta}C, respectively. The YEEDTN sequence (in bold italic) at the C terminus represents the beginning of the adjacent DuA domain. The span of the DuBR1 synthetic peptide is underlined with arrows, and underneath this is shown the alignment of this motif with the repetitive B1 and B2 motifs of FnBPA, in which putative FN-binding segments FnBPA 2 and FnBPA 3 (16) are underlined. In C, the amino acid sequence of the recombinant DuBA polypeptide derived from the FnBPB adhesin is displayed. The YEEDTN sequence (in bold italic) marks the juncture of the DuB and DuA domains as defined above. The underlined sequences are homologous to putative FN-binding segments that have been predicted to occur in the FnBPA adhesin (16), as labeled in parentheses on the right.

 
MSCRAMMs from Groups A and C streptococci also possess repetitive motifs that bind N29 (1013), which, together with the D-repeats of S. aureus MSCRAMMs, shares a conserved pattern of amino acids defined as ED(T/S)X(9,10)GGX(3,4)(I/V)DF, where acidic and hydrophobic amino acids in the C-terminal segment are essential for binding (14). The N29 fragment is itself composed of five tandem type I modules, 1F1-5F1. Each module is a {beta}-sandwich composed of two antiparallel {beta}-sheets, with {beta}-strands A and B forming a two-stranded sheet, and {beta}-strands C, D, and E comprising a three-stranded sheet (15). This three-stranded {beta}-sheet in each of the 1F1 and 2F1 modules of N29 is the ligand for a 25-mer synthetic peptide B3T derived from the Streptococcus dysgalactiae FnbB MSCRAMM, which bound the 1–2F1 module pair with a Kd of 1.0 µM (16). The B3T peptide displayed an extended linear conformation containing two {beta}-strands, each of which contributed a fourth strand to the triple-stranded {beta}-sheets in 1F1 and 2F1, forming an antiparallel {beta}-zipper. Within the B3T peptide, a cluster of alternating hydrophobic amino acids (LSIHFD-NEWP) formed contacts with tyrosine and leucine residues in 1F1, and this was preceded by an acidic motif, EDS, that engaged a basic patch in 2F1. Knowledge of these binding specificities, together with the previous identification of additional acidic and hydrophobic amino acids that are involved in ligand binding (14), also enabled the identification of putative 5F1- and 4F1-binding motifs in several different MSCRAMM-derived peptides.

Based on these known and predicted interactions, the ability of a 50-mer synthetic peptide derived from the R-repeats of the Streptococcus pyogenes SfBI adhesin to bind N29 with high affinity was proposed to involve an extended antiparallel {beta}-zipper spanning all five F1 modules (16). This was supported by showing that three consecutive overlapping synthetic peptides derived from the larger 50-mer could each bind the respective 1–2F1, 2–3F1, or 4–5F1 bimodular F1 constructs with low affinity (Kd, 0.4–113 µM), whereas the intact 50-mer bound N29 (1–5F1) with high affinity (Kd, 2 nM), and a peptide lacking only the C-terminal 1F1-binding motif was of intermediate affinity (Kd, 0.062 µM). These findings collectively suggested that (i) conserved motifs promote the binding of specific F1 modules, (ii) short peptide segments with putative motifs specific for only two F1 modules will display low affinity ligand binding, (iii) high affinity binding requires that all five F1 modules are engaged in a tandem {beta}-zipper, and (iv) the absence of a single F1-binding motif causes a significant reduction in affinity for N29.

Although this model is well suited to the S. pyogenes fibronectin-binding MSCRAMM, it leaves a number of issues unresolved for the FnBPA and FnBPB adhesins of S. aureus. Although FnBPA was predicted to possess 11 distinct Fn-binding segments based on the occurrence of appropriately spaced putative F1-binding motifs, the first 7 of these segments are N-terminal of the D-repeats and were either previously not known to bind Fn or not well characterized in terms of affinity and specificity. Additionally, although the recombinant D1–3 polypeptide binds N29 with high affinity, an obvious 1F1-binding motif does not occur anywhere in the FnBPA adhesin, and a putative 5F1-binding motif does not occur outside of the D-repeat domain (16). Hence, the majority of the predicted binding segments lack putative motifs for binding of 5F1 and 1F1 and, according to the model that was proposed, should not support high affinity ligand binding.

In this regard, the goal of our present study was to define the minimal requirement for high affinity ligand binding by the repetitive D-repeat domain and to determine whether binding segments that are N-terminal of the D-repeats are capable of high affinity ligand binding. Using bimodular D1–2 or D2–3 polypeptides, we show that the affinity is comparable with that observed for a previously described peptide derived from the SfbI adhesin of S. pyogenes that engages only four F1 modules (2–5F1) but is still an order of magnitude less than that of the D1–3 domain. Furthermore, using either soluble Fn or keratinocyte ECM as a selection method to screen a phage-display library of S. aureus genomic DNA, we isolated two distinct binding regions that are N-terminal of the D-repeats. These regions designated DuA and DuB harbored minimal binding segments DuARI and DuBRI that individually bind N29 with low affinity but, when combined as a recombinant DuBA polypeptide, display an affinity that is comparable with the D-repeats, despite their apparent lack of 1F1- and 5F1-binding motifs. Combining DuBA with D1–3 produced a polypeptide, DuBAD, that had seven or eight high affinity binding sites for N29, close to the number of predicted binding segments. Thus, our data are consistent with multiple functional ligand-binding segments in the FnBP adhesins, located in two separate high affinity domains. However, we cannot completely rationalize the observed high affinity ligand binding with the previously proposed model, and we suggest that interaction between bound molecules of N29 might contribute to high affinity binding.


    MATERIALS AND METHODS
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Bacterial Strains, Growth Conditions, and Keratinocyte Cell Culture—Multidrug-resistant S. aureus strain CMRSA-1B (isolate-317) has been described elsewhere (17, 18). Escherichia coli strains TG1 or M15 were used for maintenance of plasmids and expression of fusion peptides. Stock cultures of S. aureus and E. coli were maintained at -70 °C in 15% glycerol and grown in brain-heart infusion (Difco Laboratories, Detroit, MI) or 2YT (Difco Laboratories) broth, respectively. 2YT was supplemented with 25 µg·ml-1 kanamycin (2YTK) when required for infection of E. coli TG1 with M13K07 helper phage and with 50 µg·ml-1 ampicillin (2YTA) for selection of plasmid vectors. Media were supplemented with 15 g of agar liter-1 for preparation of solid media. All cultures were grown at 37 °C, in a static incubator for agar cultures, and a shaker-incubator with agitation at 250 rpm for liquid cultures. When grown for specific assays, the optical density of overnight cultures was measured at 600 nm (S. aureus) or 540 nm (E. coli), followed by subculturing into appropriate pre-warmed medium to achieve an initial absorbance of 0.1.

Normal human keratinocytes were obtained from neonatal foreskin and maintained in serum-free keratinocyte growth medium supplemented with bovine pituitary extract and recombinant epidermal growth factor (Invitrogen) (19). Trypsinized cells were adjusted to a density of 2 x 104 cells/ml-1, and 100-µl aliquots were transferred into wells of 96-well flat-bottom cell culture plates (Co-star Corning, Corning, NY). When the cells had achieved confluence, ECM was exposed by treating the monolayers with 0.5%Triton X-100 for 30 min at 37 °C, followed by 25 mM ammonium hydroxide for 10 min as described elsewhere (20). After rinsing with phosphate-buffered saline (PBS), excess protein binding sites were blocked by incubation with 3% bovine serum albumin in PBS before use for selection of ECM-binding phage.

Phage-display Library Construction and Screening—Phagemid vector pG8SAET (21) was kindly provided by Dr. Lars Frykberg and is designed such that blunt end ligation of randomly sonicated genomic DNA fragments into a unique SnaBI site of the vector will promote expression of cloned fragments as an N-terminal fusion to the M13 phage coat protein gpVIII. A library of {approx}0.6–0.7-kb fragments of sonicated genomic DNA from S. aureus CMRSA-1B strain 317 was constructed in pG8SAET following established methods (22, 23), producing {approx}1 x 107 ampicillin-resistant transformants, which was then amplified in E. coli TG1 to yield a phage titer of 3.3 x 1011 ampicillin transducing units·ml-1.

For binding of soluble Fn, an aliquot of phagemid library containing {approx}1010 ampicillin transducing units was incubated for 1 h with 10 µg of biotinylated Fn in 500 µl of PBS. Phage particles containing bound Fn where then captured with streptavidin-coated magnetic beads (Magna Bindä Streptavidin; Pierce), and after extensive washing with PBS containing 0.05% Tween 20, bound phage were eluted in 0.1 M glycine-HCl (pH 2.3) and then neutralized with 2 M Tris-HCl, pH 8.6, and used to reinfect E. coli TG1 cells. Amplified phage were then subjected to a second round of selection using an identical protocol. For selection on keratinocyte ECM, ~1010 ampicillin transducing units of phage diluted in PBS containing 0.1% bovine serum albumin were added to triplicate wells of a 96-well cell culture plate containing exposed keratinoctye ECM. After a 1-h incubation at room temperature with gentle agitation, the wells were washed with PBS containing 0.05% Tween 20, followed by elution of bound phage in low pH buffer and amplification in E. coli TG1 for a second round of screening. For both protocols, phage recovered from the second round of selection were used to infect E. coli TG1 cells, and cells were plated on 2YTA. Clones expressing functional fusion proteins were identified by colony blots using horseradish peroxidase-conjugated E-tag monoclonal antibody (Amersham Biosciences), specific for an epitope incorporated into pG8SAET immediately before the fusion site with the M13 phage gene VIII sequence.

DNA Sequence Analyses—Sequencing of phagemid DNA was performed by the University of Toronto Hospital for Sick Children DNA sequencing facility. Nucleotide sequences were analyzed using the MacVector program (Oxford Molecular, Oxford, UK), and the translated protein sequences were subjected to BLAST homology searches using the search engine provided by the National Center for Biotechnology Information, including access to S. aureus genome sequences.2

Expression of Recombinant Fusion Proteins—Oligonucleotide primers PG8-F (5'-cccggatccAATGCTGCGCAACACGATGACC-3') and PG8-R (5'-CTGAGGCTTGCAGGGAGTCAAAGG-3'), which flank the SnaBI cloning site of pG8SAET, were employed in PCR with phagemid DNA isolated from a clone designated DuB. The forward primer contains an added BamHI site (in lowercase bold letters) that is in-frame with the Protein A leader sequence of pG8SAET. A second BamHI site is provided by a small segment of amplified vector sequence, such that when cloned in the correct orientation in BamHI-digested pGEX2T (Amersham Biosciences), the amplicon is expressed as glutathione S-transferase fusion protein GST-DuB, encoding the complete DuB domain as presented in Fig. 1. Primers PG8-F and DuB{Delta}C-R (5'-ggggaattcAATAGAATCTTCTTCAGTTTC-3') were employed to amplify a 3'-truncation of the original DuB clone. When cloned into the BamHI and EcoRI sites of pGEX2T, the resulting plasmid pGEX2T-DuB{Delta}C directs the expression of fusion protein GST-DuB{Delta}C, containing a 26-amino acid C-terminal deletion of the DuB polypeptide. Similarly, primer DuB{Delta}N-F (5'-cccggatccGGGGTTGCATTTTACTC-3') was paired with PG8-R to produce an amplicon that was cloned into the BamHI site of pGEX2T, creating pGEX2T-DuB{Delta}N and corresponding fusion protein GST-DuB{Delta}N, lacking 26 N-terminal amino acids of DuB. An amplicon harboring both 5'- and 3'-deletions was prepared by inverse PCR of plasmid pGEX-DuB{Delta}N, with forward primer 5'-GAATATGAAGAGGATACAAAC-3' and reverse primer DuB{Delta}C-R. After digestion with EcoRI and self-ligation, the resulting plasmid pGEX-DuB{Delta}NC directs the expression of fusion protein GST-DuB{Delta}NC containing 26-amino acid deletions at both the Nand C terminus of the original DuB clone. Plasmid pGEX-DuBR1 containing a single internal repeat motif of the DuB domain was constructed by inverse PCR of plasmid pGEX-DuB{Delta}C with forward primer 5'-cccggatccGGTACAATCGAAGAAAGTAACG-3' and reverse primer 5'-CCTGAAAGATGTGTTGTACTGCC-3'. After digestion with BamHI and self-ligation, the resulting plasmid directs the expression of fusion protein GST-DuBRI harboring a 38-amino acid internal segment of the original DuB domain.

DNA encoding the contiguous DuB, DuA, and D1–3 domains of the FnBPB adhesin of S. aureus 8325–4 was amplified by PCR of genomic DNA with primers FnbB-F1 (5'-cccggatccGGCGTTGCATTTTACTC-3') and FnbB-R1 (5'-cccaagcttATTATGACCACTTACTTGTGG-3'), spanning nucleotides 1906–1922 and 2893–2913, respectively, of the fnbB gene (6). The 1.09-kb amplicon was cloned initially into pCR2.1 vector (Invitrogen) and then excised with BamHI and EcoRI, employing restriction sites provided by the forward primer and pCR2.1, respectively, such that the EcoRI end at the 3'-end of the insert is preceded by the HindIII site incorporated by the FnbB-R1 primer. This fragment was cloned into the BamHI and EcoRI sites of pGEX2T, creating plasmid pGEX-DuBAD and fusion protein GST-DuBAD. The D-repeats were deleted from pGEX-DuBAD by inverse PCR with a forward primer that is the reverse and complement of FnbB-R1 and reverse primer 5'-cccaagcttATGTTCTTCAGGTAGTTCATC-3', spanning nucleotides 2400–2380 of the S. aureus fnbB gene (6). After digestion with HindIII and self-ligation, the resulting pGEX-DuBA plasmid directs the expression of fusion protein GST-DuBA.

For plasmids constructed by inverse PCR, amplification was performed with the Expand Long-Template PCR reagent system following recommended protocols, whereas all other PCR reactions were performed with Ampli-Taq Gold DNA polymerase.

Protein Purification—Fibronectin was purified from human plasma by affinity chromatography on gelatin-Sepharose as described previously (24) and, where indicated, digested with thermolysin for subsequent generation of fragments (25), including the 29-kDa N-terminal fragment that was purified as described previously (8). Expression and purification of glutathione S-transferase fusion proteins, including the previously described GST-D1–2 and GST-D2–3 harboring the tandem D1 and D2 repeats or D2 and D3 repeats, respectively, of the FnBPA adhesin of S. aureus 8325–4, were conducted as described previously (20). All fusion proteins were treated with thrombin to release the recombinant ligand binding domains and then further purified by anion exchange chromatography (20).

Peptide Synthesis—Synthetic peptides DuARI (NPGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTKE) and DuBRI (GTIEESNDSKPIDFEYHTAVEGSEGHVEGTIETEEDSI) were synthesized with C-terminal amides by the University of Toronto Health Sciences Centre peptide synthesis core facility. Reverse phase chromatography of each peptide indicated a major product with the expected molecular mass values of 4178.2 and 4151.1 Da, as determined by analysis on a Voyager mass spectrometer.

Protein and Peptide Labeling—Purified human plasma Fn was labeled with biotinamidocaproate N-hydroxysuccinamide ester (Sigma) as described previously (26). FITC-D1–3 was prepared as described previously (8). Other fluorescent recombinant or synthetic peptides were prepared by incubation with a 10-fold molar excess of FITC in 0.2 M NaHCO3, pH 8.5, for 3 h at 37 °C. Excess dye was removed by chromatography on small size-exclusion columns. The degree of labeling was determined optically as described previously (27). The concentrations of FITC-DuBA and DuBAD stock solutions were based on the amount of valine determined by amino acid analysis.

Affinity Chromatography—Synthetic peptides DuAR1, DuBRI, and D3 were coupled to cross-linked bis-acrylamide/azlactone copolymer beads employing the protocols and reagents provided with the UltraLink Immobilization Kit (Pierce). Thermolysin-digested Fn was then applied to the affinity matrices, which were then washed extensively with 25 mM Tris-HCl, pH 7.4, containing 0.15 M NaCl and 10 mM EDTA and then eluted in wash buffer containing 6 M urea. Protein-containing fractions as determined by A280 were pooled and subjected to SDS-PAGE to visualize Fn fragments retained by the affinity matrices.

Competitive Inhibition Assays—Competitive inhibition assays were performed in Corning 96-well microtiter plates with wash buffer consisting of PBS containing 0.05% (v/v-1) Tween 20, a blocking solution of 3% (w/v-1) bovine serum albumin in PBS, and dilution buffer consisting of PBS supplemented with 0.05% Tween 20 and 0.1% bovine serum albumin. To assay binding of biotinylated Fn to recombinant GST-DuB, triplicate wells of microtiter plates were coated overnight at 4 °C with 100 µl of 1.0 µg·ml-1 GST-DuB, diluted in carbonate-bicarbonate buffer. After washing and blocking, wells were incubated with the indicated concentrations of biotinylated Fn for 1 h at room temperature on an orbital shaker. For competitive inhibition assays, biotinylated Fn was preincubated with soluble GST-DuB and its derivatives before addition to microtiter plates. After a 60-min incubation on a rocking platform, the wells were washed extensively, followed by addition of 5,000-fold diluted alkaline phosphatase-conjugated streptavidin (Roche Applied Science). Wells were again incubated for 60 min, washed extensively, and developed with 1 mg·ml-1 para-nitrophenyl phosphate substrate. Plates were read after 60 min on a Bio-Rad model 3550 microplate reader equipped with a 405 nm filter. Data are expressed as either the mean absorbance values (A405) of triplicate wells or a percentage of the A405 value determined in the absence of specific competitor.

Fluorescent Titrations—All titrations were performed in TBS (0.02 M Tris and 0.15 M NaCl, pH 7.4), pH 7.4, at 25 °C. Stock solutions of the N-terminal 29-kDa Fn fragment (N29) were added continuously to a stirred cuvette containing the FITC-labeled peptide while monitoring the anisotropy at 524 nm with excitation at 493 nm as described previously (8). The resulting concentration-dependent increases in anisotropy were fit to one of several equations. Data for the single motif peptides, DuAR1 and DuBR1, were fit to a simple binding isotherm, Equation 1 of Huff et al. (8). Data for the bimodular peptides, D1–2 and D2–3, were fit to a two-site model using the following equation:

(Eq. 1)
where K1 and K2 represent the respective dissociation constants of sites 1 and 2, and L = concentration of free N29. Because the concentration of labeled peptide was small compared with Kd, the concentration of free N29 was assumed equal to the total concentration. This assumption is not valid for titration of FITC-D1–3, FITC-DuBA, or FITC-DuBAD because of the much higher affinity. In this case, it was necessary to use a quadratic equation that takes into account the amount of titrant bound and the stoichiometry as described previously (8).

Analytical Size-exclusion Chromatography—250-µl samples of N29 fragment, alone or premixed with various concentrations of recombinant DuBA or DuBAD, were preincubated for 15 min and then injected onto a Superose-12 column using an Amersham Biosciences fast protein liquid chromatography system. The solvent was TBS, pH 7.4, at room temperature. The flow rate was 0.5 ml min-1. Elution was monitored by absorbance at 280 nm.


    RESULTS
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Identification of Ligand Binding Motifs by Phage-display—A scale diagram of FnBPA and FnBPB and the location of gene segments recovered from phagemid clones are presented in Fig. 1, A and B. Overlapping DNA segments spanning the Fn-binding D-repeats were recovered from screening with both biotinylated Fn (three clones) and keratinocyte ECM (two clones), confirming the ability of the selection procedures to recover expected Fn-binding segments. Five clones isolated only on keratinocyte ECM possessed identical segments within the C domain of FnBPA, overlapping with a previously described binding domain designated Du (28). This domain spanning amino acids 593–655 of FnBPA is designated DuA. Surprisingly, both selection procedures identified a total of 15 clones possessing identical or overlapping sequences within a central segment of FnBPB that has not been characterized previously. This domain spanning amino acids 409–535 of Fn-BPB is designated DuB.

Sequence Analysis of Binding Domains—Due to the high homology between the C-terminal halves of FnBPA and FnBPB (6), the amino acid sequence of DuA (Fig. 1A) is nearly identical in the two proteins but was assigned as originating from fnbA on the basis of nucleotide sequence. The DuA sequence is within the C domain that separates the repetitive B- and D-elements of FnBPA. A 36-amino acid internal segment of DuA is 51% identical to the R-repeats of the SfbI/PrtF adhesins from S. pyogenes (Fig. 1A) and also corresponds to predicted Fn-binding segment 5 of FnBPA (16). The amino acid sequence of DuB from S. aureus strain CMRSA-1 (Fig. 1B) shared 88% identity with known sequences of FnBPB from different S. aureus genomes and 42% identity with FnBPA. A 26-amino acid N-terminal segment of DuB shaded gray in Fig. 1B is enriched in tyrosine and contains 7 additional amino acids that are not evident in FnBPB of S. aureus 8325–4 (data not shown). A 36-amino acid internal segment of DuB is 56% identical to amino acids 506–543 and 537–571 of the FnBPA adhesin, which correspond to the B1 and B2 repeats (Fig. 1B) according to the historical nomenclature (7) and are now known to harbor predicted Fn-binding segments 2 and 3 (16). The C-terminal 26 amino acids of DuB are identical to sequences present in both FnBPA and FnBPB of S. aureus 8325–4, and the C terminus of DuB (Fig. 1C, YEEDTN) overlaps with the N terminus of DuA, indicating that these domains are contiguous. This is clarified in Fig. 1C, showing the amino acid sequence of the recombinant DuBA polypeptide derived from the FnBPB adhesin that is used later in this study, together with its complement of putative Fn-binding segments, based on comparison with the predicted Fn-binding segments of FnBPA.

Ligand Binding of DuA and DuB—Although the above sequence analysis refers to the occurrence of predicted Fn-binding segments in the DuA and DuB domains, our initial characterization of these domains was completed before the prediction of multiple ligand binding segments in the FnBPA adhesin. A series of GST fusion proteins harboring different segments of DuB was constructed and assayed for inhibition of biotinylated Fn binding to wells of microtiter plates coated with the full-length GST-DuB (Fig. 2). Soluble GST-DuB inhibited binding of biotinylated Fn with an IC50 value of 0.8 nM. Constructs lacking either the tyrosine-rich N terminus (GST-DuB{Delta}N) or the C-terminal segment that is conserved in both FnBPA and FnBPB (GST-DuB{Delta}C) as defined in the legend to Fig. 1 provided similar IC50 values of 0.4 and 0.2 nM, whereas GST-DuB{Delta}NC lacking both N- and C-terminal segments possessed an IC50 of ~1.0 nM. Furthermore, an IC50 of 40 nM was obtained with fusion protein GST-DuBR1, which possessed only the 37-amino acid internal segment of DuB that aligns to the B1 and B2 repeats of FnBPA. On this basis, a synthetic 38-mer peptide DuBRI was selected for more detailed characterization, whereas synthetic DuARI was selected on the basis of its homology to the Fn-binding R-motifs of S. pyogenes (Fig. 1A).



View larger version (34K):
[in this window]
[in a new window]
 
FIG. 2.
Inhibition of biotinylated Fn binding to GST-DuB fusion protein coated on microtiter plates, using soluble competing GST-DuB ({triangleup}), GST-DuB{Delta}N ({triangledown}), GST-DuB{Delta}C ({blacktriangledown}), GST-DuB{Delta}NC (•), and GST-DuBRI ({circ}).

 
When thermolysin-digested Fn was passed over affinity matrices containing covalently coupled DuAR1 or DuBR1 synthetic peptides, a single ~25-kDa polypeptide was retained on each column (Fig. 3), and an identical result was obtained with an affinity matrix containing the immobilized D3 peptide, which possesses the highest affinity of the D-repeats and an exclusive specificity for N29 (8). Therefore, each of the three major binding domains shares a common exclusive specificity for the N29 fragment of Fn. Titration of FITC-labeled DuAR1 or DuBR1 by fluorescence anisotropy with purified N29 provided Kd values of 1.8 and 2.0 µM, respectively (data not shown), compared with 1.8 µM for the D3 synthetic peptide (8). The 2.0 µM Kd value for DuBR1 binding to N29 was some 50-fold lower than the 40 nM IC50 value of recombinant GST-DuBR1 polypeptide, when assayed as an inhibitor of biotinylated Fn binding to the full-length DuB domain. This may reflect the fact that GST fusion proteins are expressed as dimers, and this dimerization can promote binding affinities that are orders of magnitude higher than that of the isolated binding domain (29).



View larger version (103K):
[in this window]
[in a new window]
 
FIG. 3.
SDS-PAGE of thermolysin-digested Fn (lane 1) and fragments of thermolysin-digested Fn that were retained on bis-acrylamide/azlactone copolymer affinity matrices containing covalently coupled synthetic peptides DuAR1 (lane 2), DuBR1 (lane 3), and D3 (lane 4), after elution with 6 M urea.

 
Comparison of Bimodular D-repeat Constructs—We showed previously that a recombinant polypeptide consisting of the tandem D1, D2, and D3 repeats exhibited a Kd of 1.5 nM for the N29 fragment of Fn, compared with ≥1.8 µM for the individual D repeats alone (8). The titration data obtained with the FITC-labeled D1–3 peptide indicated the presence of two equivalent high affinity binding sites, even though the three individual peptides bind with low affinity. To further explore the basis of this observation, we conducted titrations of FITC-labeled polypeptides D1–2 and D2–3, each of which contained two repeats (Fig. 4). As with our previous study of D1–3, the data fit poorly to a single-site model but exhibited a good fit with a two-site model, such that the bimodular polypeptides each possessed low and intermediate affinity binding sites. D1–2 exhibited apparent Kd values of 0.25 and 2.5 µM, whereas D2–3 exhibited values of 0.044 and 2.2 µM. Because the D1 and D2 repeats are nearly identical in amino acid sequence and possess similar Kd values of 11.4–14.0 µM for binding to the N29 fragment when assayed individually (8), it is apparent that joining the two repeats together promotes an approximate 50-fold increase in affinity for N29. Likewise, in comparing the published Kd of 1.8 µM for the D3 repeat with the high affinity Kd1 value of 0.044 µM for the D2–3 construct, there is an approximate 40-fold increase in affinity.



View larger version (25K):
[in this window]
[in a new window]
 
FIG. 4.
Fluorescence anisotropy titration of bimodular FITC-labeled D1–2 and D2–3 polypeptides with the N29 fragment of Fn. The concentration of the labeled polypeptides was 0.050 µM in TBS at room temperature. The smooth curves represent the best fit of the data to a two-site model (Equation 1 in "Materials and Methods"). The Kd values are shown.

 
Because the higher affinity Kd value of the bimodular constructs did not approach our previously reported value of 1.5 nM for the entire D1–3 domain (8), we repeated the titration of FITC-D1–3 while extending beyond the range of our previous data to include higher concentrations of N29 (Fig. 5). When these new data were fit to a quadratic expression identical to that used previously but including an additional term for the weak site(s), there was evidence for a weaker site in this construct as well with a Kd value of 0.5 µM, whereas the higher affinity interaction of 0.52 nM was close to our previously published value of 1.5 nM. The stoichiometry for the weak site could not be determined, but the number of high affinity sites was 1.7, close to the value of 1.9 obtained previously. We conclude that the D1–3 polypeptide possesses two equivalent high affinity binding sites (Kd, {approx}1 nM) and at least one lower affinity site (Kd, {approx}0.5 µM), whereas the bimodular constructs possess two sites, one with an affinity that is intermediate between D1–3 and single D-repeats, and a second whose affinity is comparable with those of the latter.



View larger version (24K):
[in this window]
[in a new window]
 
FIG. 5.
Extended titration of FITC-labeled D1–3 with the N29 fragment of Fn. The concentration of the labeled polypeptide was 0.025 µM in TBS, pH 7.4, at room temperature. The change in anisotropy was fit to a quadratic equation similar to that used in Huff et al. (8) but including an additional term for the weak site(s). The smooth line shows the best fit with the resulting parameters presented in the figure.

 
Comparison of Multidomain Constructs—The assays described above clearly define a stepwise increase in affinity for the D-repeat domain, as single repeats are extended to two and three tandem repeats. We next turned our attention to a FITC-labeled DuBA polypeptide, derived from the FnBPB adhesin as shown in Fig. 1C. The best fit of the titration data to the quadratic expression gave a Kd of 10.7 nM with n = 3.5 (Fig. 6A). This affinity is 2 orders of magnitude (200-fold) higher than either module alone and substantially higher than either of the bimodular D-repeats. A longer construct containing DuB, DuA, and all three D-repeats produced a slightly lower Kd (7.0 nM) with higher stoichiometry (n = 7.3; Fig. 6B). The dashed and dotted curves together with the insets in each panel show how the quality of the fit is diminished by arbitrarily fixing n at values above and below the best fit value. From this analysis, we conclude that the stoichiometry for DuBA could be anywhere between 3 and 4, whereas that of DuBAD is between 6 and 8.



View larger version (23K):
[in this window]
[in a new window]
 
FIG. 6.
Titration of FITC-DuBA and FITC-DuBAD with the N29 fragment of Fn. The concentration of the labeled polypeptides was 0.028 and 0.026 µM, respectively, in TBS, pH 7.4, at room temperature. Only every third data point is shown for clarity. All of the data were used when fitting to the quadratic binding equation as described by Huff et al. (8). Solid curves represent the best fits corresponding to the following parameters: for DuBA, Kd = 10.7 nM and n = 3.5; for DuBAD, Kd = 7.0 nM and n = 7.3. The dotted curve in the A shows the best fit with n arbitrarily fixed at 2.0. The dashed curves in each panel show the best fits obtained with n fixed at 5.0 for DuBA and DuBAD. The dot-dash curve in B shows the best fit obtained with n fixed at 9.0. Insets further illustrate how the error of the fits is affected by arbitrarily fixing n at different values above and below the best fit values.

 
Given the importance of stoichiometry in validating the hypothesis of multiple Fn-binding segments, additional information was obtained by size-exclusion chromatography of N29 in complex with recombinant Fn-binding polypeptides. Because of the absence of tryptophan and the low amount of tyrosine in DuBA and DuBAD, their absorbance at 280 nm is trivial compared with the N29 fragment, allowing the elution behavior of N29 to be independently monitored in the presence of varying amounts of the FNBP constructs. Typical data are shown in Fig. 7, where the N29 fragment elutes in a sharp peak near 12.5 ml whose magnitude is progressively diminished upon pre-mixing with increasing concentrations of DuBAD. This was concomitant with the appearance of an earlier peak representing elution of the complexes formed. The concentration of N29 used in these experiments was constant at 4 µM, enough to saturate the lower concentrations of DuBA and DuBAD. When the decrease of the N29 peak height is plotted against the ratio of the concentrations of DuBA (or DuBAD) to that of N29 (Fig. 8), it is clear that the peak is 90% or more depleted at a ratio less than 0.3 for DuBA and 0.15 for DuBAD (Fig. 8). The data above a peak height of 10 were fit by linear regression to obtain the solid straight lines, whose intercepts on the abscissa occur at ratios of 0.254 and 0.122, corresponding to n values of 3.9 for DuBA and 8.2 for DuBAD, in good agreement with those obtained from the anisotropy measurements.



View larger version (20K):
[in this window]
[in a new window]
 
FIG. 7.
Analytical size-exclusion chromatography of the N29 fragment of Fn alone and with various concentrations of DuBAD in TBS, pH 7.4, at room temperature. The concentration of N29 was 4.0 µM and that of DuBAD (in µM) is indicated next to the curves. Elution was monitored by absorbance at 280 nm.

 



View larger version (15K):
[in this window]
[in a new window]
 
FIG. 8.
Effect of DuBA and DuBAD on size-exclusion chromatography of the N29 fragment of Fn. Data such as those in Fig. 7 were obtained for various concentrations of DuBA and DuBAD, and the height of the peak for N29 fragment was plotted against the ratio of the concentration of DuBA (A) or DuBAD (B) to that of N29, with the latter fixed at 4 µM. In cases where more than one run was made at a given ratio, the results are shown as standard error bars. The solid lines are linear fits to all data points with peak height greater than 10.

 

    DISCUSSION
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
We have completed an analysis of the minimal requirements for high affinity binding of the 29-kDa N-terminal fragment of Fn (N29) to the FnBPB adhesin of S. aureus. In addition to the D-repeats, two prominent binding domains were identified, which we designated DuB and DuA. Our initial characterization of these domains led to the identification of two minimal binding segments, DuBRI and DuARI, which correspond to Fn-binding segments that were later predicted to occur in FnBPA (16). The precise amino acid sequence of these and most of the other Fn-binding segments that were predicted to occur within FnBPA are presented in Fig. 9, and our present work appears to have validated the functionality of most of these segments. As shown in Fig. 1C, the DuBA polypeptide does not possess an obvious equivalent of the predicted FnBPA binding segment 1. However, the DuBR1 segment is homologous to the predicted FnBPA segments 2 and 3, and this is followed by complete equivalents of the predicted Fn-binding segments 4 and 5 and a partial copy of Fn-binding segment 6. The occurrence of three complete binding segments and a partial copy of a fourth segment is in excellent agreement with the stoichiometry values of 3.5 (anisotropy) and 3.9 (size-exclusion) obtained in our analysis of N29 binding to DuBA. In addition to these segments, the DuBAD polypeptide contains a complete FnBPA segment 6, followed by segments 7–10 and a portion of segment 11 containing the C terminus of the D3 repeat. Therefore, DuBAD should contain an additional five complete known or predicted binding segments that are not present in DuBA, for a total of 9, just slightly more than our observed stoichiometry of 7 to 8. These findings strongly corroborate the existence of multiple ligand binding segments that were predicted to occur in the FnBPA adhesin, based on the occurrence of appropriately spaced putative F1-binding motifs (16).



View larger version (55K):
[in this window]
[in a new window]
 
FIG. 9.
Conserved motifs in known or predicted FN-binding segments of different MSCRAMM adhesins and their affinity for N29 (1–5F1) or F1 module pairs as indicated on the right. The amino acid sequences of the SfbI, B3T, and FnBPA 1, 1b, 2–7, and 9–11 peptide segments, including the respective Kd values for binding of N29 or F1 module pairs when known (ND, not determined), are as described previously (16). The D1, D2, D2a, D2b, D3, and D3b peptides corresponding to the D-repeats of S. aureus FnBPA and their respective Kd values (NI, no detectable interaction) for N29 or F1 module pairs are as described by Huff et al. (8), whereas the DuARI and DuBRI sequences and respective Kd values for N29 are derived from the present study. The E-strands in each of the five F1 modules comprising the N29 fragment of Fn are depicted by open arrows in antiparallel configuration, above the consensus motifs that are proven or predicted to bind the individual F1 modules (16). Proven motifs consist of the underlined sequences EDS and IHFDNEWP in the B3T peptide, which contribute side-chain interactions toward binding of the 2F1 and 1F1 modules, respectively (16). Putative motifs that have been proposed to bind 2F1, 4F1, and 5F1 in other known or predicted Fn-binding segments are also underlined (16), and motifs that are common to multiple segments are indicated by asterisks in the top and bottom consensus lines. The?? notations in the consensus lines highlight an additional potential motif consisting of GF or GQ (shown in bold italic) in several known FN-binding segments, which is in an appropriate location to engage 3F1. The bottom of Fig. 9 presents our interpretation of Kd and stoichiometry data for N29 binding to the D1–3 polypeptide and its derivatives, including individual synthetic peptides and bimodular D1–2 and D2–3 polypeptides. Additional detail is provided in "Results" and "Discussion."

 
We have further shown that the individual DuARI and DuBRI segments each bind N29 with low affinity, whereas the larger DuBA polypeptide that harbors these and other functional segments displays an ~200-fold greater affinity than either DuARI or DuBRI alone. Similar traits are exhibited by the D-repeats, where bimodular constructs containing two tandem D-repeats display an affinity for N29 that is intermediate between individual repeats, and the trimodular D1–3 polypeptide. The increased affinity of the bimodular D1–2 and D2–3 polypeptides compared with individual repeats can be explained by the model proposed by Schwarz-Linek et al. (16) to define the molecular basis of high affinity N29 binding (Kd, 2 nM) to 50-amino acid synthetic peptide SfbI493–542, derived from the R-repeats of the S. pyogenes PrtF/SfbI MSCRAMM. However, the greater affinity of D1–3 compared with the bimodular polypeptides and the high affinity of the DuBA domain are more difficult to reconcile by this model.

As shown in Fig. 9, the high affinity (Kd, 0.002 µM) of the SfbI493–542 peptide is attributed to a series of conserved motifs that promote formation of a {beta}-zipper structure that spans the five F1 modules in the N29 domain of Fn. This high affinity peptide could be subdivided into smaller segments (SfbI491–512, SfbI511–528, and SfbI518–542) that bound specific pairs of F1 modules with much lower affinity (Kd, 0.4–113 µM). Although the specificity was not rigorously addressed, it was proposed that conserved motifs in each of these three segments are specific only for the indicated pairs of F1 modules. This was most evident with the SfbI518–542 segment, which bound 1–2F1 with a Kd of 0.4 µM. This was attributed to two motifs, EDT and FHFDNNEP, which closely resemble motifs in the B3T peptide derived from FnbB of S. dysgalactiae and are known to engage 1F1 and 2F1, respectively, when bound in tandem to the 1–2F1 module pair with a Kd of 1.0 µM (16). The inference is that peptide segments that bind only two F1 modules are expected to display low micromolar Kd values, and high affinity binding requires that all five F1 modules be engaged in a tandem {beta}-zipper. The reduced strength of a four-module {beta}-zipper is evident from the 0.062 µM Kd of SfbI456–492, which lacks only the 1F1-binding motif and yet displayed a 30-fold loss of affinity for N29 compared with SfbI493–542 (Fig. 9). Because FnBPA of S. aureus lacks an obvious 1F1-binding motif (16), the ability of the D1–3 polypeptide to bind N29 with an affinity comparable with that of SfbI493–542 must be accounted for by mechanisms that do not involve direct binding of 1F1.

Our interpretation of how the complement of binding motifs that are either proven or predicted to engage specific F1 modules should facilitate binding of N29 to the D1–3 polypeptide and its derivatives is displayed at the bottom of Fig. 9. The 1F1 module, which is connected to 2F1 by a flexible linker (15), is depicted as being displaced from the interface of N29 with D1–3. Thus, D1–3 is shown to possess an array of motifs sufficient to bind two molecules of N29 in an antiparallel {beta}-zipper involving the 2–5F1 modules, as supported by our titration data indicating two equivalent high affinity sites (Kd, ~1 nM). The C terminus of D1–3 represented by KPSYGFGGHNSVDFEEDTLPKV is shown to bind a third molecule of N29 by engaging a 4–5F1 module pair, which should account for the lower affinity binding site Kd of 0.5 µM that was observed here in titration of D1–3 with N29. This is supported by our previous study showing that synthetic D3b peptide containing this same sequence could bind 4–5F1 with a Kd of 4.6 µM (8) but showed no detectable interaction with 1–2F1 or 2–3F1.

This same explanation applies to the common low affinity sites shared by the D1–2 and D2–3 polypeptides (Kd, 2.5 and 2.2 µM), which we attribute to the respective C-terminal segments (GGNIIDIDFDS and GGHNSVDFEEDT) that possess putative motifs for binding of 4–5F1 (Fig. 9). The higher affinity sites, with Kd of 0.25 µM for D1–2 and 0.044 µM for D2–3, can be explained by the joining of the individual peptides to form intact segments 9 and 10, allowing formation of antiparallel {beta}-zippers that engage four F1 modules, 2–5F1 (Fig. 9). In support of this notion, the Kd of 0.044 µM for D2–3 is very close to that of the SfbI456–492 peptide of S. pyogenes, which has the same complement of four binding motifs and possesses a Kd of 0.062 µM for N29 (16). However, the additional 40–250-fold increase in affinity that occurs when all three D repeats are fused cannot be explained on this basis because D1–3 contains no new junctures beyond those already present in either D1–2 or D2–3. The only thing new is that D1–3 has two four-motif sites (two complete segments, segments 9 and 10) in close proximity, which prompts us to suggest that cooperative interactions between bound N29 molecules may lend additional stability to the complex. Recall in this regard that the N29 domain of Fn serves a critical role in the self-assembly of Fn fibrils in the extracellular matrix (30).

The seven predicted Fn-binding segments that are N-terminal of the D domain also lack a 1F1-binding motif and, judging by the alignment in Fig. 9, should also lack a 5F1 motif because the GG couplets implicated in binding to this module are either absent or, in the case of DuARI, significantly out of register. Whereas this suggests that binding of N29 to these segments involves up to three F1 modules (2–4F1; Fig. 9), the ~2 µM Kd values obtained here for DuARI and DuBRI are of similar magnitude to those of other peptides (e.g. D3b, B3T, SbfI511–528, and Sfb518–542) that are either known or predicted to bind just two F1 modules. Nonetheless, when the DuB and DuA domains are expressed in tandem as the recombinant DuBA polypeptide, we observed strong binding of N29 with a Kd of ~10 nM and stoichiometry of 4, in agreement with its complement of binding segments (Figs. 1C and 9). However, in this situation, joining of the DuB and DuA domains does not result in the creation of any intact segments that extend the length of the tandem {beta}-zipper, which as described above could satisfactorily explain the increased affinity when two D-repeats are joined to one another. Once again, although we cannot exclude an as yet unrecognized means of binding 1F1 and/or 5F1, we are inclined to attribute this gain in affinity to interactions between bound molecules of N29.

In further considering the role of different motifs in binding of specific F1 modules, we note that the original description of conserved motifs did not define an obvious consensus for binding of 3F1 in any of the known or predicted FN-binding segments (16). On closer inspection, our attention is drawn to a motif consisting of GF or GQ in the SfbI binding segments and also in some of the FnBPA segments of S. aureus, in a location to conceivably engage 3F1 (Fig. 9). A role for GF or GQ in binding of 3F1 is implicated in noting that two peptides, SfbI511–528 (TGMSGFSETVTIVEDTRP) and FnBPA #1b (LTGQYDKNLVTTVEEEYDSS) both bound 2–3F1 with respective Kd values of 3.6 and 0.5 µM (16), similar to other peptides that are known or predicted to bind two F1 modules. Within these segments, the respective EDT and EEY sequences are putative 2F1-binding motifs, and it is assumed that the reported Kd values cannot be accounted for on the strength of the 2F1-binding motif alone. This is supported by our previous observation that the D2a peptide, which is now known to possess only a single putative 2F1-binding motif (Fig. 9), showed no detectable interaction with N29 (8).

This potential 3F1-binding motif is less obvious in DuBRI (GH) and DuARI (GA), and we have already noted that the affinity of these segments does not surpass that of other peptides that bind only two F1 modules. Therefore, it remains to be determined whether a significant 3F1-binding motif exists in these and other segments. Potentially, sequences located between the 2F1 and putative 4F1-binding motifs could contribute to a {beta}-zipper through backbone hydrogen bonding and maintain alignment of the MSCRAMM peptide along the interface with N29, even in the absence of side-chain interactions. Similar considerations may apply to binding of 5F1, which has already been noted to involve relatively few and weak side-chain interactions (31). The prominence of glycine in predicted 5F1 (GG) and 3F1 (GQ, GF) binding segments would be consistent with the maintenance of relatively weak backbone hydrogen bonding, whereas the flanking 4F1 and 2F1 interactions are anchored by stronger hydrophobic and electrostatic interactions. Additional studies are needed to address these issues, explore other properties of these peptides, and elucidate the atomic structures of additional complexes.


    FOOTNOTES
 
* This work was funded by the Aventis Pasteur-University of Toronto Research Program, Funded Research 72012558, and the Premiers Research Excellence Award (to M. J. M.). The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. Back

** To whom correspondence should be addressed: S112 Dept. of Microbiology, Sunnybrook and Women's College Health Science Centre, 2075 Bayview Ave., Toronto, Ontario M4N 3M5, Canada. Tel.: 416-480-5831; Fax: 416-480-5737; E-mail: martin.mcgavin{at}sw.ca.

1 The abbreviations used are: MSCRAMM, microbial surface components recognizing adhesive matrix molecules; Fn, fibronectin; PBS, phosphate-buffered saline; GST, glutathione S-transferase; FITC, fluorescein isothiocyanate; ECM, extracellular matrix. Back

2 www.ncbi.nlm.nih.gov/sutils/genom_table.cgi. Back



    REFERENCES
 TOP
 ABSTRACT
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 

  1. Lowy, F. D. (1998) N. Engl. J. Med. 339, 520-532[Free Full Text]
  2. Sheagren, J. N. (1984) N. Engl. J. Med. 310, 1368-1373[Medline] [Order article via Infotrieve]
  3. Weigel, L. M., Clewell, D. B., Gill, S. R., Clark, N. C., McDougal, L. K., Flannagan, S. E., Kolonay, J. F., Shetty, J., Killgore, G. E., and Tenover, F. C. (2003) Science 302, 1569-1571[Abstract/Free Full Text]
  4. Foster, T. J., and Höök, M. (1998) Trends Microbiol. 6, 484-488[CrossRef][Medline] [Order article via Infotrieve]
  5. Patti, J. M., Allen, B. L., McGavin, M. J., and Höök, M. (1994) Annu. Rev. Microbiol. 48, 585-617[Medline] [Order article via Infotrieve]
  6. Jonsson, K., Signas, C., Muller, H. P., and Lindberg, M. (1991) Eur. J. Biochem. 202, 1041-1048[Medline] [Order article via Infotrieve]
  7. Signas, C., Raucci, G., Jonsson, K., Lindgren, P. E., Anantharamaiah, G. M., Höök, M., and Lindberg, M. (1989) Proc. Natl. Acad. Sci. U. S. A. 86, 699-703[Abstract/Free Full Text]
  8. Huff, S., Matsuka, Y. V., McGavin, M. J., and Ingham, K. C. (1994) J. Biol. Chem. 269, 15563-15570[Abstract/Free Full Text]
  9. House-Pompeo, K., Xu, Y., Joh, D., Speziale, P., and Hook, M. (1996) J. Biol. Chem. 271, 1379-1384[Abstract/Free Full Text]
  10. Lindmark, H., Jacobsson, K., Frykberg, L., and Guss, B. (1996) Infect. Immun. 64, 3993-3999[Abstract]
  11. Lindgren, P. E., McGavin, M. J., Signas, C., Guss, B., Gurusiddappa, S., Höök, M., and Lindberg, M. (1993) Eur. J. Biochem. 214, 819-827[Medline] [Order article via Infotrieve]
  12. Molinari, G., and Chhatwal, G. S. (1999) J. Infect. Dis. 179, 1049-1050[CrossRef][Medline] [Order article via Infotrieve]
  13. Talay, S. R., Valentin-Weigand, P., Jerlstrom, P. G., Timmis, K. N., and Chhatwal, G. S. (1992) Infect. Immun. 60, 3837-3844[Abstract/Free Full Text]
  14. McGavin, M. J., Gurusiddappa, S., Lindgren, P. E., Lindberg, M., Raucci, G., and Höök, M. (1993) J. Biol. Chem. 268, 23946-23953[Abstract/Free Full Text]
  15. Potts, J. R., Bright, J. R., Bolton, D., Pickford, A. R., and Campbell, I. D. (1999) Biochemistry 38, 8304-8312[CrossRef][Medline] [Order article via Infotrieve]
  16. Schwarz-Linek, U., Werner, J. M., Pickford, A. R., Gurusiddappa, S., Kim, J. H., Pilka, E. S., Briggs, J. A., Gough, T. S., Höök, M., Campbell, I. D., and Potts, J. R. (2003) Nature 423, 177-181[CrossRef][Medline] [Order article via Infotrieve]
  17. Huesca, M., Peralta, R., Sauder, D. N., Simor, A. E., and McGavin, M. J. (2002) J. Infect. Dis. 185, 1285-1296[CrossRef][Medline] [Order article via Infotrieve]
  18. Papakyriacou, H., Vaz, D., Simor, A., Louie, M., and McGavin, M. J. (2000) J. Infect. Dis. 181, 990-1000[CrossRef][Medline] [Order article via Infotrieve]
  19. Kondo, S., Kono, T., Sauder, D. N., and McKenzie, R. C. (1993) J. Investig. Dermatol. 101, 690-694[CrossRef][Medline] [Order article via Infotrieve]
  20. Huesca, M., Sun, Q., Peralta, R., Shivji, G. M., Sauder, D. N., and McGavin, M. J. (2000) Infect. Immun. 68, 1156-1163[Abstract/Free Full Text]
  21. Zhang, L., Jacobsson, K., Vasi, J., Lindberg, M., and Frykberg, L. (1998) Microbiology 144, 985-991[Abstract]
  22. Jacobsson, K., and Frykberg, L. (1995) BioTechniques 18, 878-885[Medline] [Order article via Infotrieve]
  23. Jacobsson, K., and Frykberg, L. (1996) BioTechniques 20, 1070-1078[Medline] [Order article via Infotrieve]
  24. Miekka, S. I., Ingham, K. C., and Menache, D. (1982) Thromb. Res. 27, 1-14[CrossRef][Medline] [Order article via Infotrieve]
  25. Borsi, L., Castellani, P., Balza, E., Siri, A., Pellecchia, C., De Scalzi, F., and Zardi, L. (1986) Anal. Biochem. 155, 335-345[CrossRef][Medline] [Order article via Infotrieve]
  26. McGavin, M. J., Zahradka, C., Rice, K., and Scott, J. E. (1997) Infect. Immun. 65, 2621-2628[Abstract]
  27. Ingham, K. C., and Brew, S. A. (1981) Biochim. Biophys. Acta 670, 181-189[Medline] [Order article via Infotrieve]
  28. Joh, D., Speziale, P., Gurusiddappa, S., Manor, J., and Höök, M. (1998) Eur. J. Biochem. 258, 897-905[Medline] [Order article via Infotrieve]
  29. Mikhailenko, I., Krylov, D., Argraves, K. M., Roberts, D. D., Liau, G., and Strickland, D. K. (1997) J. Biol. Chem. 272, 6784-6791[Abstract/Free Full Text]
  30. Wierzbicka-Patynowski, I., and Schwarzbauer, J. E. (2003) J. Cell Sci. 116, 3269-3276[Abstract/Free Full Text]
  31. Penkett, C. J., Dobson, C. M., Smith, L. J., Bright, J. R., Pickford, A. R., Campbell, I. D., and Potts, J. R. (2000) Biochemistry 39, 2887-2893[CrossRef][Medline] [Order article via Infotrieve]