|
Advertisement | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
J. Biol. Chem., Vol. 281, Issue 6, 3690-3697, February 10, 2006
Human C4b-binding Protein, Structural Basis for Interaction with Streptococcal M Protein, a Major Bacterial Virulence Factor*![]() ![]() ![]() ![]() ![]() 1
From the
Received for publication, October 25, 2005 , and in revised form, November 30, 2005.
Human C4b-binding protein (C4BP) protects host tissue, and those pathogens able to hijack this plasma glycoprotein, from complement-mediated destruction. We now show that the first two complement control protein (CCP) modules of the C4BP -chain, plus the four residues connecting them, are necessary and sufficient for binding a bacterial virulence factor, the Streptococcus pyogenes M4 (Arp4) protein. Structure determination by NMR reveals two tightly coupled CCP modules in an elongated arrangement within this region of C4BP. Chemical shift perturbation studies demonstrate that the N-terminal, hypervariable region of M4 binds to a site including strand 1 of CCP module 2. This interaction is accompanied by an intermodular reorientation within C4BP. We thus provide a detailed picture of an interaction whereby a pathogen evades complement.
Bacteria that enter human blood or tissues will be opsonized by complement and destroyed by phagocytes unless they have a means of overcoming attack by the complement system. An extensively studied example of such a virulence mechanism is the ability of many Streptococcus pyogenes M proteins to bind the key human complement regulator C4b-binding protein (C4BP)2, an interaction that endows the bacteria with resistance to phagocytosis (1). C4BP is a polymeric, soluble, glycoprotein ( 200 mg/liter in plasma) (2). The M proteins, classical bacterial virulence factors first recognized over 75 years ago (3), are fibrillar surface structures exhibiting antigenic variation within a 50-100-amino acid residue hypervariable N terminus (4, 5). Expression of M protein is important for the ability of S. pyogenes to cause the diseases associated with this pathogen: acute pharyngitis and impetigo (6). Many other pathogens share the ability to sequester C4BP (7-12). Thus escape from complement attack by hijacking of C4BP is emerging as a widespread contributor to immune evasion strategies and is a therapeutic target.
The complement system, a vital molecular component of innate immunity, consists of plasma and cell-surface proteins that conspire to rid the body of infectious particles (13, 14). Because complement is potentially harmful to host tissue it is tightly regulated. Like other members of the regulators of complement activation (RCA) protein family, the plasma protein C4BP acts upon the bimolecular C3 convertases that are the main drivers of the complement cascade. The C3 convertases cleave and thereby activate the third component of complement, C3, leading to deposition of C3b on the surface of an unprotected particle such as an invading microorganism. This process, known as opsonization, marks the particle as a target for phagocytosis. C3b also nucleates assembly of further convertase complexes and progression of the cascade toward formation of the membrane attack complex. C4BP regulates the C3 convertase of the classical pathway, a complex of C4b and C2a, by acting as a cofactor for the proteolysis of C4b (15, 16) and accelerating the decay of C4b·C2a complexes deposited on host cells (17). It binds self-surface glycosaminoglycans where it is maximally effective in preventing complement activation. C4BP additionally acts as a regulator of the alternative pathway (18), participates in apoptosis (19), and binds CD40 (20) and DNA (21).
The predominant isoform of C4BP has seven The C4BP-binding M proteins of S. pyogenes interact with a C4BP region close to the C4b-binding site, but sites for binding natural and pathogen-borne proteins appear non-identical (27). The bacterial protein adheres more tightly than C4b and is able to displace C4b from its binding site. When bound by a streptococcal M protein, C4BP is still capable of regulating complement and thus protecting the organism upon which it is sequestered from complement-mediated destruction. Unlike in the case of all other RCA proteins there has, until now, been no experimental three-dimensional structural information available for C4BP. Hence the atomic resolution basis of its interactions with pathogen-borne and natural ligands has remained unknown. Opportunities for rational design of therapeutic interventions, e.g. to counter streptococcal infections or to inhibit complement-mediated inflammation, have consequently been limited. Here we demonstrate which domains of C4BP are involved in binding to an M protein of S. pyogenes and present the solution structure of the relevant fragment of C4BP. This has allowed us to delineate in detail the binding sites on the surface of C4BP for the M protein.
Expression, Purification, and Sample PreparationHuman C4BP CCP1-2 (C4BP12) cDNA was amplified by PCR yielding the protein sequence: MNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGY-VRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKT-DLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEILE-HHHHHH. This was cloned in the Bluescript vector using the PCR-Script cloning kit (Stratagene, La Jolla, CA) and transferred into pET16 vector (Novagen, Merck Biosciences, Nottingham, UK) using NdeI and XhoI. The DNA was transfected into BL21 (DE3) CodonPlus-RP Escherichia coli, which were cultured in Luria-Bertani broth containing kanamycin and chloramphenicol (37 °C). After cooling (30 °C), expression was induced with isopropyl- -D-thiogalactopyranoside and bacteria grown for 5 h. The bacteria were then centrifuged and resuspended in cold phosphate-buffered saline, lysed, and sonicated. The sonicate was centrifuged and the pellet resuspended in 6 M guanidine HCl, 20 mM Tris-HCl, pH 8.0, 10 mM reduced glutathione. The crude material was applied to a nickel-nitrilotriacetic acid Superflow column ( 100 ml, Qiagen), and the protein eluted with the same guanidinium buffer plus 0.7 M imidazole. Refolding conditions (from Heiring and Muller (28)) were screened using a conformation-dependent monoclonal antibody and buffer 11 (55 mM Tris-HCl, pH 8.5, 10.6 mM NaCl, 2.2 mM CaCl2, 2.2 mM MgCl2, 0.055% polyethyleneglycol-4000, 0.55 M arginine, 0.1 mM oxidized glutathoine, 1 mM reduced glutathione) selected. Pooled fractions containing C4BP12 were diluted (20 mg/liter) in buffer 11 and incubated overnight. Iodoacetamide was added to 5 mM, and the solution incubated (30 min, 4 °C) and dialyzed against 50 mM Tris-HCl, pH 8.5. The protein solution was then applied to an 10-ml SourceQ column (Amersham Biosciences, Uppsala, Sweden) and correctly folded C4BP12 eluted with 50 mM sodium phosphate buffer, pH 8.5. 15N and 13C, 15N labeling was achieved using M9 medium supplemented with 15NH4Cl and [13C]glucose. NMR samples were prepared by adding a protease inhibitor mixture (Sigma, Gillingham, UK) and 0.05% (v/v) NaN3 and concentrating to 500 µl, followed by three rounds of 10-fold dilution in NMR buffer (20 mM deuterated NaOAc, pH 4.5, 0.05% NaN3) and concentration. The final sample volume was 600 µl with protein concentrations of 1.3 mM(15N) or 2.5 mM (13C, 15N), containing 10% (v/v) D2O.
NMR SpectroscopyNMR spectra were acquired (37 °C) on Bruker AVANCE 600 and 800 MHz spectrometers. Spectra for the titration of M4-derived peptide with C4BP12 were acquired (600 MHz) using a cryo-probe. Spectra were processed using AZARA (W. Boucher, Department of Biochemistry, University of Cambridge, UK). Resonance assignment was performed using ANSIG (29). Distance restraints were derived from 15N-edited and 13C-edited NOESY-heteronuclear single quantum coherence (HSQC) experiments (mixing times = 100 ms). Steady-state 1H-15N NOEs and 15N T1 and T2 values were measured at two field strengths. For experiments to measure residual dipolar couplings (RDCs) the sample was aligned in Pseudomonas filamentous (Pf1) phage (Profos, Regensburg, Germany) with a 2H splitting of 0.9 Hz. Sample conditions were: 0.70 mM C4BP12, 7.3 mg/ml Pf1 phage, 20 mM NaOAc, pH 5.5, 90 mM NaCl. 1DNH, 1DC Structure CalculationNOE intensities were converted into distance categories of 0 -2.7 Å, 0 -3.3 Å, 0 -5.0 Å, and 0 -6.0 Å. The distance restraints, along with four disulfide bonds (defined by homology) and torsion angle restraints calculated from chemical shift index data, were used as input for the structure calculation performed with CNS-solve (30). As calculations progressed, iterative "filtering" of ambiguously assigned NOEs removed duplicates and assignments contributing <1% to the total NOE. The RDC restraints were used only in the final refinement by including the TENSO energy term within CNS-solve using a harmonic potential. Residual dipolar couplings for some residues were excluded on the basis of heteronuclear NOE data. A total of 100 structures were calculated. Titration with M4-NThe peptide dimer, M4-N, was expressed in E. coli, as described.3 Briefly, the part of the M4 gene corresponding to the hypervariable region (residues 1-45) was amplified from plasmid pARP401 (31), cloned into expression vector pET3a, and expressed in E. coli. The codon for a cysteine was added to the 3' end of the construct to facilitate dimerization of the expressed protein via a disulfide bridge. Dimerization was achieved by oxidation of bacterial lysates with 20 mM CuCl2 in 0.4 M NaCl, pH 8.0 (32). The dimerized peptide was purified by ion chromatography and gel filtration and was finally dialyzed against doubly distilled H2O. Lyophilized peptide was dissolved in NMR buffer (deuterated NaOAc, pH 6.0) to give 100 µM (dimer concentration). A 20 µM 15 solution of C4BP12 in the same buffer was added and a series of 15N-1H HSQC spectra were subsequently recorded at M4-N concentrations of 100, 50, 25, and 10 µM (dimer concentrations) and compared with a reference spectrum for a sample containing no M4-N.
M4 Binding AssayMicrotiterplates were incubated (overnight, 4 °C) with 50 µl of solution containing 10 µg/ml full-length M4 protein, expressed and purified as described in Stenberg et al. (33) in 75 mM sodium carbonate, pH 9.6. Wells were washed with 50 mM Tris-HCl, 0.15 M NaCl, 0.1% Tween 20, pH 7.5 (washing buffer) and then incubated (room temperature) with 200 µl of quench solution (washing buffer plus 3% fish gelatin). After re-washing, increasing concentrations of recombinant C4BP mutants (see Ref. 24) diluted in 50 mM Tris-HCl, 150 mM NaCl, pH 8.0, supplemented with 0.1% bovine serum albumen and 0.1% Tween 20 were added and the plates incubated (4 h, room temperature). Plates were then washed and incubated with biotinylated monoclonal antibody 67 (against CCP4) or monoclonal antibody 104 (against CCP1) diluted in quench solution. After 1 h of incubation, plates were washed and incubated (1 h) with streptavidin-conjugated horseradish peroxidase (Dakopatts, Glostrup, Denmark), washed again, and developed. The results are shown as a percentage of the maximal binding of recombinant wild type C4BP obtained in each set of triplicate experiments. Isothermal Titration CalorimetryExperiments were performed (25 °C) on a VP-isothermal titration calorimetry (ITC) microcalorimeter (MicroCal Inc., Northampton, MA). The cell contained 0.01 mM C4BP12 (1.4 ml) and the syringe contained 0.15 mM M4-N. Both solutions were in 10 mM sodium phosphate buffer, pH 6.0. For titrations, one preliminary injection of 1 µl was made, followed by 19 injections of 10 µl with an injection speed of 0.5 µl/s. The stirring speed was 310 rpm; delay time between injections = 3 min. A blank titration, i.e. injecting M4-N into buffer, was used to correct the M4-N:C4BP12 titration.
CCPs 1 and 2 of C4BP -Chain Are Necessary and Sufficient for Binding the Hypervariable Domain of M4To define the C4BP region involved in M protein binding, deletion mutants of the -chain were tested for binding to the M protein, M4 (Fig. 1A). None of CCP modules 3-8 were required for M4 binding, but deletion of CCP2 led to significantly reduced affinity. Deletion of CCP1 destroyed binding almost completely. In further investigations, the linking sequences between CCPs 1, 2, 3, and 4 of the -chain were engineered by insertions of Ala residues (Fig. 1B). Addition of residues between CCP2 and CCP3, or between CCP3 and CCP4, had no effect on binding, whereas insertions between CCP1 and CCP2 caused a loss of M4 binding. A recombinant protein consisting of residues 1-124 of C4BP -chain (see Fig. 1C, C4BP12), His-tagged at the C terminus, was expressed in E. coli and refolded. ITC was used (Fig. 1D) to measure the binding affinity between C4BP12 and a dimerised peptide corresponding to the hypervariable region of M4 (residues 1-45 of M4 protein with a C-terminal Cys added. A dimer (M4-N) was created because previous studies had shown dimerization of M4 strongly enhanced C4BP binding (32). The results are consistent with a 1:1 stoichiometry, and Kd = 0.5 µM. Taken together, the data summarized in Fig. 1 prove that the N-terminal two CCP modules of C4BP -chain along with the four residues that link them are necessary and sufficient for M4 recognition. The data confirm that M4-N constitutes a useful model of the C4BP-binding region of the bacterial protein (32).
The Structure of C4BP12 Has Been DeterminedTo further characterize the M4-binding site of C4BP, the structure of C4BP12 was solved using NMR. There were no doubled peaks in the 15N-1H HSQC spectrum of C4BP12, i.e. there was no indication of multiple conformations. Each of the eight Pro residues is trans as indicated by the difference in chemical shifts, C - C (34), and appropriate, strong NOE cross-peaks. A total of 1250 inter residue restraints were employed in the structure calculation, along with 895 ambiguous restraints. These were supplemented by 192 residual dipolar couplings (RDCs) collected on an aligned sample of C4BP12 prepared in the presence of filamentous phage. An ensemble of 40 structures was selected from 100 calculated, on the basis of lowest energy arising from experimental restraints (Table 1 and Fig. 2, A-C). The quality of the structures, as judged by the Ramachandran plot (Table 1), is acceptable for a small protein domain with disordered loops (see below); 90% of residues within the ensemble occur in the most favored and additionally allowed regions of the plot.
The structures of the individual modules converge well (Table 1, Fig. 2, A and B). Each has a similar, elongated shape (Fig. 2D) in which short -strands and other extended segments (that do not satisfy the criteria used to define -strands (35)) are aligned with the long axis. Five strands/extended segments wrap around a hydrophobic core that is bounded by the two invariant disulfide bridges. The strands/extended segments run up-down-up-down-up such that the N and C termini are at opposite ends of the module. The connecting turns and loops also generally lie toward the ends of the module, but the "hypervariable loop," a site of high sequence variation and of insertions or deletions (see Fig. 1C), projects laterally (Fig. 2D). The longer hypervariable loop of CCP1 is poorly defined by the data and corresponds to a prominent dip in the plot of heteronuclear NOEs (Fig. 3), consistent with motion on the nanosecond timescale. A second poorly defined, flexible (as judged by NOEs and the high T1/T2 ratio of Thr45) region of CCP1 includes residues 35-45 (Fig. 3) and is close to, but does not participate in, the interface. A prominent feature of CCP2 is the loop (residues Val108-Val113), between the fourth and fifth extended segments, that carries a three-residue insertion relative to CCP1. This loop is flexible, as judged by heteronuclear NOEs, (see Fig. 3B), and it lies close to the intermodular interface. In general, T1/T2 ratios and heteronuclear NOEs are more variable in CCP1 than in CCP2 (Fig. 3, A and B), reflecting a higher level of flexibility in the first module.
The Two N-terminal CCP Modules of C4BP Residues Involved in Binding to M4 Mapped by Chemical Shift PerturbationSignificant changes in the 15N-1H HSQC spectrum of C4BP12 occurred upon addition of M4-N (Fig. 4). At a low ratio (0.5:1) of M4-N to C4BP12, some cross-peaks disappear, while others move a small distance within the spectrum. As this ratio is increased, those peaks that had previously vanished reappear at a new frequency, while those that had moved shift further from their original positions. The disappearance and subsequent reappearance of some peaks reflects exchange between free and bound forms of C4BP12 with a frequency comparable with the difference between the frequencies of the original peak (free) and the new one (bound). On the other hand, when the difference between the frequencies of the original peak and the new one is smaller, then the exchange rate is faster relative to the frequency difference, giving rise to the peaks that move incrementally during the course of the titration. The line widths of the cross-peaks for the complex are not significantly broader than those of free C4BP12, despite the increased molecular mass of the complex (15 kDa for C4BP12 + 11.3 kDa for M4-N). One explanation is that the complex is less anisotropic than free C4BP12 and tumbles accordingly; this could happen if the bound form of M4-N is relatively compact and binds toward the center of C4BP12, as opposed to at either end.
Most of the significantly perturbed residues (Fig. 5) are in the intermodular linking sequence or in loops or turns near the intermodular interface. From the surface representation (Fig. 5A) it is obvious that these residues do not all lie on one face of the molecule. It is therefore improbable that they are all simultaneously involved in contacting the peptide. More likely the chemical shifts of some of these residues are perturbed by re-orientation of the two modules upon M4-N binding. Within CCP2, however, two stretches of residues distant from the interface have significantly perturbed chemical shifts. These do form a contiguous surface and together comprise a feasible binding patch. The protein engineering experiments described above establish that residues from the interface-proximal region of module 1, and/or in the linker, additionally contribute directly to binding.
C4b-binding protein is sequestered by several S. pyogenes strains (36) whereupon the complement regulatory activity of this polymeric protein protects the invading bacteria (1). C4b-binding protein adheres to the streptococcal M proteins, but the structural details of the protein-protein interactions involved have remained obscure. Our module deletion and ITC-based approach showed that the two N-terminal CCP modules of the C4BP -chain, and a four-residue linker between them, are necessary and sufficient for binding of the S. pyogenes M protein, M4. This observation is in good agreement with previous module deletion experiments (37), using whole bacteria, that localized the S. pyogenes binding site to CCPs 1-3, with CCP2 absolutely required, while deletion of CCP3 had only a marginal effect. The ITC-based measurements proved that a recombinantly expressed fragment of the C4BP -chain (C4BP12) composed of residues 1-124, and therefore encompassing CCP1 and CCP2, binds tightly to a dimerized form of a peptide derived from the N-terminal region of M4 (M4-N) and thus that the C4BP-M protein interaction is amenable to structural analysis. To circumvent the possibility that crystal-packing forces, or the presence of high concentrations of precipitants, might influence inter-modular angles (38) the structure of C4BP12 was determined in solution.
Comparison of the Structure of C4BP12 with Other CCP Structures While each module has the structural features expected of a CCP module, a pair-wise comparison of CCP1 and CCP2 (using combinatorial extension (39)) yielded a C
A prominent structural feature of C4BP12 is the loop in CCP2 formed by the residues between Val108 and Val113 (sequence: QDRG). The presence of such a loop, four mostly polar residues bounded by two hydrophobic residues that can contribute to the interface with the preceding module, is unique to cluster C CCP modules (40). Since cluster C members form the second modules of C3b/C4b recognition sites in C4BP, MCP, DAF, and both sites 1 and 2 of CR1, some conservation among these modules in the use of specific features for C3b/C4b binding might be expected. Indeed this loop is critical to the C3b/C4b binding activities of CR1 sites 1 and 2 (43, 44). It is therefore an obvious candidate for future mutagenesis. Interaction with M ProteinsPerturbations of C4BP12 chemical shifts that accompany association with M4-N implicate in binding residues toward the middle of the module pair, while the N terminus of CCP1 and the C terminus of CCP2 are not involved. This is consistent with a complex that is globular, rather than linear, as also inferred from the relatively narrow line widths of its NMR signals. The extent and distribution of affected residues are most convincingly explained by a ligand-induced intermodular conformational adjustment. Three side chains exert ring current shifts in the vicinity (Fig. 5C), one from each of CCPs 1 and 2 and one in the linker (Tyr37, Tyr62, and Phe84, respectively). Thus movements between modules and associated conformational adjustments of loops would result in large chemical shift changes. In earlier studies, K63Q, a substitution that could not be accommodated without perturbing the intermodular interface observed in the structure, had little effect on M4 binding (27). Considered in conjunction with the Ala insertion experiments, this implies that while the four-residue length of the linker is critical for M4 binding, the interface composition, and hence the relative arrangement and flexibility of the two modules in the free protein, is not. This conclusion is consistent with a change of modular orientation upon binding, i.e. the bound conformation being different from the free one. The mutants R64Q and H67Q each displayed reduced M4 binding; on the other hand R66Q and K79Q increased affinity. In the current study, all four of these mutated residues experience significant perturbations of chemical shift upon addition of M4-N. From the structure it is apparent that none of these mutations involve a residue that participates in the interface, rather Arg64 and His67 form a potential M4-binding patch on the surface of CCP2. Note that bovine, murine, and rat C4BP lack one or both of Arg64 and His67 and are indeed unable to bind M protein (37). Arg 66 and Lys79 flank His67, and the gain of affinity resulting from the R66Q and K79Q substitutions could be explained if the native residues impede access to the M4 binding site either because of their positive charge (see below) or by virtue of their steric bulk. The lack of dependence on salt and pH suggest that binding of M4 requires other forces apart from electrostatics (27). In general, the pattern of effects on M4 binding that result from mutagenesis of charged residues is consistent with an interaction in which electrostatics steer the two components toward a productive interaction, but other forces are critical to stabilize the complex eventually formed. Thus while some mutations inhibit binding, others increase it, and some mutations compensate for one another. It is unsurprising that selected substitutions in C4BP improve binding; the interaction is unlikely to be optimal in terms of affinity, since the two partners are under opposing evolutionary influences in this respect. Furthermore, the interaction is not specific to M4; other M proteins with different hypervariable domains also bind to C4BP. Interpretation of Mutagenesis Data for C4b and Glycosaminoglycan BindingThe current structural and chemical shift perturbation data demonstrate that M4 binding involves an intermodular reorientation of C4BP12. This is the first experimental evidence in support of intermodular flexibility being important for the ligand-binding properties of a mammalian RCA protein. In the light of this, it seems likely that such conformational flexibility could also be important for binding to the natural ligands, C4b and glycosaminoglycans. Indeed, critical residues, Arg39 Lys63, Arg64 and His67, implicated by mutagenesis are not clustered together in the structure of the free protein (Fig. 5B) but could be brought into juxtaposition by a twist between the modules creating an interaction that is dominated by electrostatic forces. In the case of DAF23 a similar hypothesis was suggested as an explanation for the pattern of functionally critical mutants within the solution structure (45). Moreover, the aforementioned lack of consistency among intermodular angles within C3b/C4b-binding regions of the free RCAs could be explained if each undergoes a conformational change upon binding, perhaps converging on a common C3b/C4b-bound orientation that is necessary for cofactor and/or decay-accelerating activity.
The avoidance of phagocytosis necessitates sequestration at the bacterial surface of sufficient, functionally active, C4BP. For its own protection, the host cell may also sequester C4BP, a process that relies on the presence of glycosaminoglycan-binding sites; each
The atomic coordinates and structure factors (code 2A55) have been deposited in the Protein Data Bank, Research Collaboratory for Structural Bioinformatics, Rutgers University, New Brunswick, NJ (http://www.rcsb.org/). The chemical shift assignments for C4BP12 have been deposited at the BioMagResBank under accession number 6712.
* This work was supported by the Swedish Research Council (to A. M. B. and G. L.), the Swedish Foundation for Strategic Research (INGVAR) (to A. M. B.), the Medical Research Council of the United Kingdom (to P. N. B. and H. T. J.), and the Wellcome Trust. The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. 1 To whom correspondence should be addressed: Schools of Chemistry and Biological Sciences, Joseph Black Chemistry Bldg., University of Edinburgh, West Mains Road, Edinburgh EH9 3JJ, Scotland, UK. Tel.: 44-131-650-4727; Fax: 44-131-650-7055; E-mail, Paul.Barlow{at}ed.ac.uk.
2 The abbreviations used are: C4BP, C4b-binding protein; C4BP12, C4BP modules 1 and 2;CCP, complement control protein; CR1, complement receptor type 1; DAF, decay accelerating factor; MCP, membrane cofactor protein; ITC, isothermal titration calorimetry; NOE, nuclear Overhauser effect; RCA, regulator of complement activation; HSQC, heteronuclear single quantum coherence; M4-N, a dimer of amino acid residues 1-45 from M4; r.m.s.d., root mean square deviation.
3 I. André, J. Persson, A. M. Blom, H. Nilsson, T. Drakenberg, G. Lindahl, and S. Linse, submitted for publication.
We thank Prof. Björn Dahlbäck who developed monoclonal antibodies used in this study, Dr. Ingemar André and Prof. Sara Linse for help with cloning and purification of M protein constructs, Dr. Lena Kask for help in experimental work, Dinesh Soares for help with Combinatorial Extension, and Dr. Brian Smith for advice on structure calculations.
This article has been cited by other articles:
|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Advertisement | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||