![]()
|
|
||||||||
J. Biol. Chem., Vol. 281, Issue 8, 4903-4910, February 24, 2006
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||




1
From the
Department of Molecular Biology and Microbiology, School of Medicine, Case Western Reserve University, Cleveland, Ohio 44106 and the
Department of Pathology, Brigham and Women's Hospital and Harvard Medical School, Boston, Massachusetts 02115
Received for publication, June 13, 2005 , and in revised form, December 22, 2005.
| ABSTRACT |
|---|
|
|
|---|
| INTRODUCTION |
|---|
|
|
|---|
The extracellular domain of PTPµ contains sequence motifs similar to those in cell adhesion molecules including: a MAM domain, an immunoglobulin (Ig) domain, and four fibronectin type-III repeats (3). The MAM domain (Meprins, A5, PTP Mu) is a sequence motif that is suggested to play a role in protein dimerization (4). Ig domains are disulfide-bonded structures found in many cell surface proteins and have been shown to mediate homophilic and heterophilic binding between cell adhesion molecules. Fibronectin type-III motifs, originally identified in the extracellular matrix protein fibronectin, are present in many cell adhesion molecules. PTPµ has been shown to mediate homophilic binding in non-adhesive Sf9 insect cells (5, 6). The juxtamembrane domain of PTPµ contains a region of homology to the conserved intracellular domain of the cadherins. Cadherins are calcium-dependent adhesion molecules that mediate cell-cell adhesion and adherens junction formation (7). Cadherins are anchored to the actin cytoskeleton indirectly through the binding of catenins (7). The catenin family of proteins includes
-catenin,
-catenin, plakoglobin, and p120 catenin. We have demonstrated that PTPµ interacts with classical cadherins such as N-cadherin, E-cadherin, and R-cadherin and associates with these cadherins in a complex containing
-catenin and
-catenin (8, 9). PTPµ was also shown to bind p120 catenin (10). PTPµ has two conserved intracellular catalytic domains, of which only the membrane-proximal domain has been shown to be catalytically active (11). The cell adhesion-like extracellular domain of PTPµ, its intracellular catalytic domain and ability to interact with the cadherin/catenin complex, make PTPµ an attractive candidate for regulating cadherin-mediated adhesion and migration. In support of this idea, we demonstrated that re-expression of PTPµ in LNCaP cells restores E-cadherin-mediated cell-cell adhesion (12). Furthermore, PTPµ expression and catalytic activity are required for N-cadherin mediated neurite outgrowth (13).
In a continuing effort to understand the PTPµ signaling pathway, we set out to identify potential PTPµ substrates and interacting proteins using a previously published strategy (14). PTPs have a conserved aspartate residue, which serves as a general acid during catalysis. The structural data on the PTP catalytic domain suggest that mutation of the aspartate residue to alanine (D-A) creates a "substrate trap" by affecting only the Vmax and not the Km of the phosphatase (15). Holsinger et al. (14) used a fusion protein consisting of an intracellular D1205A mutant of the RPTP, DEP-1, fused to glutathione S-transferase (GST), to isolate substrates from lysates of cells treated with the protein-tyrosine phosphatase inhibitor pervanadate. They found that DEP-1 associates with p120-catenin. Palka et al. (16) performed similar experiments with DEP-1 and identified additional substrates including the hepatocyte growth factor receptor (met) and Gab1 as well as p120-catenin. We generated a D1063A mutant using the intracellular domain of PTPµ (iPTPµDA) and expressed it as a bacterial GST fusion protein. The iPTPµDA fusion protein was used in pull-down assays with A549 cell lysates and associated proteins were identified by immunoblotting. Using this strategy, we identified IQGAP1 as a PTPµ-interacting protein.
IQGAP1 was originally identified as a putative RasGAP based on a region of IQGAP1 with significant homology to the catalytic domain of RasGAPs (17). IQGAP1 neither exhibits RasGAP activity nor binds to Ras but directly interacts with the Rho GTPases, Rac1 and Cdc42, in their GTP-bound state (18). IQGAP1 has no GAP activity toward Cdc42 or Rac1. In fact, IQGAP1 stabilizes Cdc42 in its GTP-bound state (19-21). In addition to a RasGAP-related domain, IQGAP1 contains a calponin homology domain, a WW domain, and four IQ motifs, similar to the ones found in unconventional myosins, that mediate interactions of IQGAP1 with calmodulin (17, 19, 22). The presence of several protein-interacting domains suggests IQGAP1 functions as a scaffolding protein. In addition to Cdc42 and Rac1, IQGAP1 interacts with E-cadherin (23, 24), N-cadherin (25),
-catenin (23, 26), CLIP-170 (27), actin (28-30), and ERK2 (p42 MAPK) (31).
It is well established that members of the Rho-family of GTPases regulate actin cytoskeleton remodeling. The most well known members of this family include Cdc42, Rac1, and RhoA, which generate the formation of filopodia, lamellipodia, and stress fibers, respectively (32). IQGAP1 represents a protein that can link cytoskeletal proteins to Rho-family GTPases, specifically Cdc42 and Rac1 (20, 27-29, 33). In this manuscript, we demonstrate that IQGAP1 is a novel PTPµ-interacting protein. We show that the interaction between PTPµ and IQGAP1 is direct and enhanced by activated Cdc42 and to a lesser extent, Rac1. Furthermore, we demonstrate PTPµ regulates neurite outgrowth via IQGAP1.
| EXPERIMENTAL PROCEDURES |
|---|
|
|
|---|
-catenin, and E-cadherin were purchased from Transduction Laboratories (San Diego, CA). An antibody to phospho-p44/42 MAPK (p-ERK1/2) was purchased from New England Biolabs (Beverly, MA). An antibody to calmodulin was purchased from Upstate%20Biotechnology">Upstate Biotechnology (Lake Placid, NY). An anti-HA-peroxidase antibody used to detect the Rho GTPase fusion proteins was purchased from Roche Applied Science. A polyclonal antibody generated against the extracellular domain of PTPµ (494) and a monoclonal antibody generated against the intracellular domain of PTPµ (SK18) have been described previously (5, 34). A monoclonal anti-phosphotyrosine antibody was a gift from Nick Tonks (Cold Spring Harbor Laboratory) and has been described previously (35). A monoclonal antibody to N-cadherin was a gift from Margaret Wheelock (University of Nebraska) and has been described previously (36). Cell CultureA549 non-small cell lung carcinoma cells were maintained in F-12 media (Invitrogen) supplemented with 10% fetal bovine serum, 2 mM L-glutamine, and 1 µg/ml gentamicin at 37 °C, 5% CO2. Sf21 insect cells were maintained in Sf-900 II SFM media (Invitrogen) at 27 °C.
Expression of Fusion Proteins in Escherichia coliPlasmids containing intracellular PTPµ GST fusion proteins (iPTPµ-JMD, iPTPµ-
765-815, iPTPµWT, iPTPµCS, iPTPµDA, iPTPµWT-
D2, iPTPµDA-
D2) or GST alone were expressed in E. coli under the control of the lac promoter. The iPTPµ-
765-816 (B4), iPTPµWT (B5), and iPTPµCS (B5m) have been described (11). We generated the iPTPµDA construct (D1063A mutation) using site-directed mutagenesis. We generated the iPTPµWT-
D2 and iPTPµDA-
D2 constructs by restriction digestion of iPTPµWT and iPTPµDA, respectively, with BamHI, which cuts at 3532 bp. iPTPµ-JMD was generated by restriction digest of iPTPµWT-
D2 with AccI and ClaI. To isolate functional iPTPµ-GST fusion proteins, proteins were isolated from E. coli as follows. Bacteria were resuspended in 10 ml of resuspension buffer (0.1 M NaCl, 10 mM Tris-HCl, pH 8.0, and 1 mM EDTA) and incubated on ice for 15 min. To lyse bacterial cells 1 ml of 0.5 M EDTA, 1.1 ml of 20% Triton X-100, 55 µl of 1 M dithiothreitol, 10 µl of
-mercaptoethanol, 100 µl of 100 mM phenylmethylsulfonyl fluoride, and 30 µl of protease inhibitor cocktail (Sigma) was added to 10 ml of resuspended cells. Cells were sonicated and spun at 15,000 rpm for 25 min. GST fusion proteins were isolated from the cleared supernatant using glutathione-Sepharose 4B beads (Amersham Biosciences). Expression and protein concentration of GST fusion proteins was determined by Coomassie stain. Isolated fusion proteins adsorbed onto glutathione-Sepharose were used in the GST pull-down experiments as described below. For pull-down assays performed in the absence of pervanadate treatment, GST fusion proteins were isolated from E. coli using PBST (1% Triton X-100, 1 mM benzamidine, and protease inhibitor cocktail in PBS).
GST Pull-down ExperimentsA549 cells were grown to 85-95% confluence. Cells were collected by scraping into lysis buffer containing 20 mM Hepes, pH 7.5, 1% Nonidet P-40, 150 mM NaCl, 1 mM EDTA, 1 mM benzamidine, and protease inhibitor cocktail. Cells were incubated on ice for 30 min and then centrifuged at 3000 rpm for 3 min. The supernantant was saved and its protein concentration determined using the Bradford method (37). Equal amounts of protein (1 mg) were added to equal amounts of the iPTPµ GST constructs or GST alone adsorbed to glutathione-Sepharose. Samples were rocked at 4 °C for 2.5 h, washed four times with lysis buffer, and incubated at 95 °C for 5 min in 2x SDS sample buffer. One-third of the sample was resolved by SDS-PAGE and transferred to nitrocellulose for immunoblot analysis as described previously (8). Pull-down experiments using purified His-IQGAP1 from Sf21 cells were performed in PBS, 1% Triton X-100, 1 mM benzamidine, and protease inhibitor cocktail.
Isolation of TAT Fusion ProteinsTAT fusions of the Rho family GTPases Cdc42, Rac1, and RhoA were obtained from Dr. Steven Dowdy (University of California San Diego, La Jolla, CA). The Rho GTPase fusion proteins contain an N-terminal His6-tag for purification, a TAT-tag for protein transduction, and a HA-tag for protein detection (38). The fusion proteins were expressed in E. coli under the control of the lac promoter and purified on TALON metal affinity resin (Clontech, Palo Alto, CA). Expression and protein concentration of TAT fusion proteins was determined by Bradford assay and verified by immunoblot using anti-HA-tag antibodies.
Purification of His-IQGAP1IQGAP1 was cloned into pFast Bac HT as follows. The gene for full-length IQGAP1 was cut from pcDNA3-Myc-IQGAP1 (39) with XbaI and partially digested with BamHI. The construct was inserted into pFast Bac HT at BamHI and XbaI sites. pFast Bac HT-IQGAP1 was transformed into DH10 Bac. The recombinant Bacmid DNA of IQGAP1 was isolated and used to infect Sf21 insect cells. Forty-eight h post-infection, Sf21 cells were lysed and His-IQGAP1 purified using the QIAexpress Ni-NTA Fast Start kit (Qiagen, Inc., Valencia, CA) as indicated in the manufacturer's protocol with the modification that 1% Triton was included in all buffers with the exception of the elution buffer. Purity of the His-IQGAP1 protein was determined by silver stain and verified by immunoblot with a monoclonal anti-IQGAP1 antibody.
|
Baculovirus Infection of A549 CellsBaculovirus containing a mammalian expression plasmid for GFP-tagged wild-type PTPµ was generated as previously described using the pBacMam-2 vector from Novagen (40). For co-localization studies, A549 cells were plated in Lab Tech II chamber slides 24 h prior to infection with baculovirus. For infection, 200 µl of viral supernatant was added to chamber slide wells containing cells in 200 µl of medium and incubated 2 h at 37°C,5%CO2. After the 2-h incubation, all medium was removed from the cells and replaced with media containing 150 nM trichostatin A (Sigma). Cells were incubated at 37 °C, 5% CO2 overnight. The following day immunocytochemistry for IQGAP1 was performed as described above.
ImmunoprecipitationsA549 cells were grown to 90% confluence. Cells were washed twice with PBS and treated with the cross-linking reagent DSP (1 mM, Pierce) for 10 min at room temperature. Tris, pH 7.5, was added to 50 mM for 15 min at room temperature, then the cells were washed once with PBS. Cells were lysed in 50 mM Tris, pH 7.5, 1% Triton X-100, 150 mM NaCl, 1 mM benzamidine, and protease inhibitor cocktail. Samples were sonicated and centrifuged at 10,000 rpm for 5 min. Supernatants were saved and protein concentrations determined using the Bradford method. Immunoprecipitations were performed with equal amounts of supernatant protein (400 µg) using protein A-Sepharose (Amersham Biosciences) preloaded with a rabbit polyclonal antibody directed to an extracellular epitope of PTPµ (494) or non-immune rabbit serum. Samples were rocked at 4 °C for 3-4 h. Beads were washed four times with lysis buffer and heated to 37 °C for 15 min and 95 °C for 5 min in 2x SDS sample buffer. Immunoprecipitated proteins were resolved by SDS-PAGE and immunoblot.
Bonhoeffer Stripe AssayThe stripe assay used was a modified version of the Bonhoeffer method (41) described previously (42). Briefly, tissue cultures dishes were coated with nitrocellulose (43) and allowed to dry before applying a silicon lane matrix to the dish. Alternating stripes of laminin and PTP-Fc chimera containing Texas Red-conjugated bovine serum albumin (for visualization of the lanes) were generated as follows. 80 ng of PTPµ-Fc chimera (described previously; Ref. 44) was injected into the channels of the silicon lane matrix, incubated for 10 min, aspirated, and then replaced with a fresh aliquot of the same substrate two additional times. All remaining binding sites within the lanes were blocked with bovine serum albumin (fraction V; Sigma) and rinsed with calcium-magnesium-free phosphate buffer. The matrix was removed, and 1.75 µg of laminin (Biomedical Technologies Inc., Stoughton, MA) was spread across the lane area and incubated for 20 min. Explants from E8 chick nasal retina were grown on the alternating stripes of laminin and PTPµ for 48 h. Quantitation of the stripe assays was performed using a rating scale previously described (45, 46). Neurites that show no preference for either substrate are assessed at 0. Neurites that grow exclusively on one substrate are assessed at 3. Neurites that grow mainly on the laminin lanes with an occasional neurite crossing over the PTPµ lanes are assessed at 2, while an assessment of 1 is given when there is a significant amount of neurite crossing but a tendency to fasciculate on laminin. To perturb IQGAP1 function, a 6 µM concentration of either a TAT-tagged, scrambled peptide or an IQGAP1 peptide containing an N-terminal TAT protein transduction sequence was added at the time of explant. The IQGAP1 peptide corresponds to amino acids 1054-1077 of IQGAP1 plus the N-terminal TAT sequence (GRKKRRQRRRMVVSFNRGARGQNALRQILAPVVK, synthesized by Genemed Synthesis, San Fransico, CA). A peptide comprising amino acids 1054-1077 of IQGAP1 (MK24) is known to compete the interaction of IQGAP1 with Cdc42 and Rac1 (47).
| RESULTS |
|---|
|
|
|---|
Ala) creates a "substrate trap" by affecting only the Vmax and not the Km of the phosphatase (15). The "substrate trapping" mutant (Asp
Ala) retains normal affinity for its substrate but catalysis is reduced; therefore it binds irreversibly to its substrate. We used a series of intracellular PTPµ-GST fusion proteins (Fig. 1), including a D1063A mutant (iPTPµDA), immobilized on glutathione-Sepharose in pull-down assays to identify PTPµ-interacting proteins. Lysates from confluent A549 cells treated with or without the tyrosine phosphatase inhibitor, pervanadate, were incubated with the GST fusion proteins, and associated proteins were resolved by SDS-PAGE and identified by immunoblot. The iPTPµCS construct possesses a mutation in which an essential cysteine residue is mutated to a serine (C1095S), leaving the protein catalytically inactive. The iPTPµ-
765-815 construct lacks part of the PTPµ juxtamembrane domain. In our system, both the C1095S and D1063A mutant constructs (iPTPµCS and iPTPµDA) act equally well to "trap" potential substrates based on immunoblot data using a phosphotyrosine antibody to detect associated proteins in the presence of pervanadate (data not shown).
|
765-815, which has reduced affinity for several of the proteins we examined (Fig. 2 and data not shown), suggesting the juxtamembrane domain may alter protein folding or the affinity of protein-protein interactions. In addition to IQGAP1, other known IQGAP1-interacting proteins were detected in the pull-down assays including calmodulin and ERK2 (p42 MAPK), in both its unphosphorylated and phosphorylated, active form, suggesting PTPµ interacts with IQGAP1 in a complex. These data do not provide evidence either for or against the possibility that IQGAP1 is a substrate for PTPµ due to the fact that substrates can bind in both the phosphorylated and unphosphorylated form (10, 48, 49). The slight variation in binding of IQGAP1 and ERK2 seen in the absence or the presence of pervanadate is not observed in all experiments. Equal loading of GST fusion proteins was confirmed by Ponceau staining of the nitrocellulose membrane (data not shown). After our initial pull-down experiments, we generated both a wild-type and D1063A mutant construct lacking the second phosphatase domain, iPTPµWT-
D2 and iPTPµDA-
D2, respectively. These constructs are more efficiently expressed in bacteria due to their smaller size and behave similarly to the full-length intracellular constructs with respect to the binding of IQGAP1 (Fig. 3A). These data indicate that PTPµ interacts with this complex via its juxtamembrane or first phosphatase domain.
Constitutively Active Cdc42 Enhances the Binding of IQGAP1 to PTPµMembers of the Rho family of GTPases are known to induce cytoskeletal changes involved in cell adhesion and motility (50, 51). The most well studied members of this family are Cdc42, Rac1, and RhoA, which induce filopodia, lamellipodia, and stress fibers, respectively (32, 52-54). IQGAP1 is a known regulator of Cdc42, and several IQGAP1 functions show dependence on activated, GTP-bound Cdc42. We were interested in determining the effect of activated Cdc42 on the interaction of IQGAP1 with PTPµ. To address this question, we added purified, constitutively active (CA) or dominant negative (DN) Cdc42, Rac1 and RhoA to pull-down assays using the iPTPµWT-
D2 and iPTPµDA-
D2 constructs. Constitutively active mutants of the Rho GTPases have defective GTPase activity, keeping them in a GTP-bound state (53). Dominant negative constructs of the Rho GTPases preferentially bind GDP over GTP and inhibit endogenous GTPases by titrating out guanine nucleotide exchange factors required for their activation (52, 55). The data in Fig. 3 show that in the presence of CA-Cdc42 there is a striking increase in the binding of IQGAP1 to both iPTPµWT-
D2 and iPTPµDA-
D2 fusion proteins, 2.4-fold (average of 2.4, n = 3) and 2.6-fold (average of 2.9, n = 3), respectively. CA-Rac1 also caused an increase in the PTPµ/IQGAP1 interaction but to a lesser extent, 1.6-fold (average of 2.0, n = 2) and 1.3-fold (average of 1.5, n = 3), respectively. No significant change in binding is seen with CA-RhoA, consistent with the lack of interaction between IQGAP1 and RhoA (19). Similarly, none of the DN constructs significantly altered the PTPµ/IQGAP1 interaction (Fig. 3). The association of the known PTPµ-interacting protein, RACK1 (56), is not altered by the addition of the Rho GTPases (Fig. 3). These data indicate that CA-Cdc42 and CA-Rac1 association with IQGAP1 enhances its interaction with PTPµ. These data also suggest that PTPµ may regulate Cdc42- and/or Rac1-dependent functions of IQGAP1. Fig. 3D shows that CA-Cdc42 causes an increase in IQGAP1 binding to the full-length intracellular PTPµ constructs similar to that seen with the truncated PTPµ constructs, demonstrating that the increase in binding is not unique to the truncated constructs.
|
|
|
Endogenous PTPµ and IQGAP1 Interact in VivoTo further characterize the PTPµ/IQGAP1 interaction, we examined the localization of endogenous PTPµ and IQGAP1 in A549 cells as well as their ability to co-immunoprecipitate. In A549 cells PTPµ accumulates at cell-cell contacts in high cell density cultures (Fig. 5) as described previously in other cell types (8, 57). At low cell density, PTPµ stains diffusely in the cytoplasm of single cells and concentrates where cell-cell contacts have formed in adjacent cells (Fig. 5). IQGAP1 is known to associate with cortical actin filaments (19, 29) and to localize at cell-cell contacts (24, 58). In agreement with these data, IQGAP1 accumulates at cell-cell contacts in high cell density cultures of A549 cells (Fig. 5). At low cell density, IQGAP1 remains mostly cytoplasmic but concentrates in the lamellipodia (Fig. 5) as described in other cell types (19, 58).
To get a better understanding of where PTPµ and IQGAP1 might associate, we did co-localization studies using A549 cells expressing GFP-tagged full-length PTPµ. When adjacent cells are just touching, PTPµ-GFP is concentrated at the tips of filopodia extensions making initial contacts (Fig. 6a), whereas IQGAP1 is concentrated in the lamellipodia (Fig. 6b). As cell contacts form, PTPµ-GFP accumulates in a broad band spanning the area of contact (Fig. 6d). At this point, a portion of the IQGAP1 redistributes to the nascent contact (Fig. 6e) and co-localizes with PTPµ-GFP (Fig. 6g). As suggested by immunocytochemistry of endogenous proteins (Fig. 5), PTPµ-GFP and IQGAP1 co-localize at cell-cell contacts (Fig. 6, g and k).
|
100 kDa each, which remain tightly associated via a non-covalent interaction (34). The intracellular fragment is detected in Fig. 7 as well as full-length, unprocessed PTPµ. Furthermore, the IQGAP1-interacting proteins N-cadherin, E-cadherin, and
-catenin are also detected in a complex that immunoprecipitates with PTPµ, suggesting PTPµ may regulate the cadherin/catenin complex via IQGAP1. IQGAP1 Is Required for PTPµ-mediated Neurite OutgrowthPTPµ is a permissive substrate for E8 chick nasal retinal ganglion cells (RGCs) (42, 46). Bonhoeffer stripe assays were used to determine the effect of perturbing IQGAP1 on PTPµ-mediated crossing of nasal retinal ganglion cells. Stripe assays measure the preference of neurites to grow on different substrates such as laminin and PTPµ. Both laminin and PTPµ are permissive substrates for E8 chick nasal RGC neurites. As shown in Fig. 8A (Control), nasal RGC neurites freely cross between the laminin and PTPµ lanes. Addition of a membrane-permeable, TAT-tagged IQGAP1 competitive peptide corresponding to the Cdc42 and Rac1 binding site on IQGAP1 completely abolishes nasal RGC neurite crossing onto the PTPµ substrate without affecting growth on the laminin lanes, suggesting that IQGAP1 is required for PTPµ-mediated crossing of nasal RGC neurites (Fig. 8A, IQGAP1). This peptide, comprising amino acids 1054-1077 of IQGAP1 (MK24), is known to compete the interaction of IQGAP1 with Cdc42 and Rac1 (47). Addition of a membrane-permeable, TAT-tagged scrambled peptide did not inhibit PTPµ-mediated crossing (Fig. 8A, Scrambled). Quantitation of the stripe assays was performed as described previously (45, 46) and is shown in Fig. 8B. These data show that the IQGAP1 competitive peptide induces nasal RGC avoidance of the PTPµ substrate lanes, demonstrating that IQGAP1 is required for PTPµ-mediated neurite outgrowth.
|
| DISCUSSION |
|---|
|
|
|---|
Cellular functions known to be regulated by PTPµ include cadherin-mediated cell adhesion (12), N-cadherin-mediated neurite outgrowth (13), and axon guidance (42, 46, 59). Similar to PTPµ, IQGAP1 has been shown to regulate cadherin-medited cell adhesion (23, 24, 60, 61) and to induce neurite outgrowth (62), suggesting PTPµ and IQGAP1 share a common signaling pathway. In addition, both PTPµ homophilic binding (44) and IQGAP1 overexpression (20) induce a filopodial dominant phenotype dependent on active Cdc42. Many IQGAP1 functions are dependent on active Cdc42, including cross-linking of actin filaments (29, 33), capture and stabilization of microtubule plus ends via binding to CLIP-170 (27), stabilization of E-cadherin-mediated adhesion junctions via release of
-catenin (60), promotion of cell migration (63), and the inhibition of E-cadherin endocytosis (61). Our data show activated Cdc42 enhances the binding of IQGAP1 to PTPµ suggesting PTPµ can regulate this complex and, therefore, potentially IQGAP1 activities.
|
(62, 64). Li et al. (62) demonstrated that IQGAP1-induced neurite outgrowth in N1E-115 cells is augmented by phosphorylation at Ser-1443. Phosphorylation of Ser-1443 has also been shown to influence the binding of nucleotide-depleted Cdc42 in vitro by opening up the C terminus of IQGAP1 and revealing novel Cdc42 binding sites (64). The implications of IQGAP1 binding to nucleotide-depleted Cdc42 are currently unclear. The fact that Ser-1443 enhances neurite outgrowth induced by IQGAP1 is of interest because both PTPµ-mediated outgrowth and axon guidance of retinal ganglion cells involve the novel PKC, PKC
(46, 65). We propose that PKC and IQGAP1 are part of a common signaling pathway initiated by PTPµ homophilic binding. Future studies in our laboratory will explore this possibility.
Regardless of whether IQGAP1 is a tyrosine-phosphorylated substrate for PTPµ, PTPµ could modify IQGAP1 activity by regulating IQGAP1 binding partners. This could be accomplished by conformational changes induced by the binding of IQGAP1 to PTPµ. We have provided evidence that active Cdc42 enhances the binding of IQGAP1 to PTPµ independent of phosphatase activity (Fig. 4). Alternatively, several IQGAP1-associated proteins are potential tyrosine-phosphorylated substrates for PTPµ such as classical cadherins,
-catenin and Cdc42. Changes in the tyrosine phosphorylation status of these proteins could alter their ability to interact with IQGAP1.
Immunocytochemistry data predict that PTPµ and IQGAP1 interact initially at nascent cell-cell contacts. It is intriguing to postulate that IQGAP1, downstream of PTPµ homophilic binding, facilitates changes in the actin cytoskeleton leading to cell adhesion and adherens junction formation. This hypothesis is supported by reports indicating filopodia extensions initiate cell-cell adhesion (66). This scenario is applicable to neurite outgrowth and axon guidance as well as cell adhesion, since all of these processes involve sensing adjacent cells and responding to the environment. This idea is supported by the data presented in Fig. 8, which clearly show IQGAP1 is involved in PTPµ-mediated neurite outgrowth of nasal RGC neurons.
| FOOTNOTES |
|---|
1 To whom correspondence should be addressed: Dept. of Molecular Biology and Microbiology, Case Western Reserve University, 10900 Euclid Ave., Cleveland, OH 44106-4960. Tel.: 216-368-0330; Fax: 216-368-3055; E-mail: susann.brady-kalnay{at}case.edu.
2 The abbreviations used are: PTP, protein-tyrosine phosphatase; RPTP, receptor PTP; GST, glutathione S-transferase; GAP, GTPase-activating protein; ERK2, extracellular signal-regulated kinase 2; MAPK, mitogen-activated protein kinase; PKC, protein kinase C; HA, hemagglutinin; PBS, phosphate-buffered saline; GFP, green fluorescent protein; DSP, dithiobis(succinimidyl propionate); CA, constitutively active; DN, dominant negative; RGC, retinal ganglion cell. ![]()
| ACKNOWLEDGMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
D. M. Shasby Cell-cell adhesion in lung endothelium Am J Physiol Lung Cell Mol Physiol, March 1, 2007; 292(3): L593 - L607. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Wang, T. Watanabe, J. Noritake, M. Fukata, T. Yoshimura, N. Itoh, T. Harada, M. Nakagawa, Y. Matsuura, N. Arimura, et al. IQGAP3, a novel effector of Rac1 and Cdc42, regulates neurite outgrowth J. Cell Sci., February 15, 2007; 120(4): 567 - 577. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||