|
Advertisement | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
J. Biol. Chem., Vol. 282, Issue 10, 7450-7456, March 9, 2007
FXYD6 Is a Novel Regulator of Na,K-ATPase Expressed in the Inner Ear*![]() ![]() ![]() ![]() ![]() 1
From the
Received for publication, October 20, 2006 , and in revised form, December 21, 2006.
The exquisite sensitivity of the cochlea, which mediates the transduction of sound waves into nerve impulses, depends on the endolymph ionic composition and the endocochlear potential. A key protein in the maintenance of the electrochemical composition of the endolymph is the Na,K-ATPase. In this study, we have looked for the presence in the rat inner ear of members of the FXYD protein family, recently identified as tissue-specific modulators of Na,K-ATPase. Only FXYD6 is detected at the protein level. FXYD6 is expressed in various epithelial cells bordering the endolymph space and in the auditory neurons. FXYD6 co-localizes with Na,K-ATPase in the stria vascularis and can be co-immunoprecipitated with Na,K-ATPase. After expression in Xenopus oocytes, FXYD6 associates with Na,K-ATPase 1- 1 and 1- 2 isozymes, which are preferentially expressed in different regions of the inner ear and also with gastric and non-gastric H,K-ATPases. The apparent K+ and Na+ affinities of 1- 1 and 1- 2 isozymes are different. Association of FXYD6 with Na,K-ATPase 1- 1 isozymes slightly decreases their apparent K+ affinity and significantly decreases their apparent Na+ affinity. On the other hand, association with 1- 2 isozymes increases their apparent K+ and Na+ affinity. The effects of FXYD6 on the apparent Na+ affinity of Na,K-ATPase and the voltage dependence of its K+ effect are distinct from other FXYD proteins. In conclusion, this study defines the last FXYD protein of unknown function as a modulator of Na,K-ATPase. Among FXYD protein, FXYD6 is unique in its expression in the inner ear, suggesting a role in endolymph composition.
The mammalian inner ear is composed of two distinct sensory organs, the cochlea (the organ of hearing) and the vestibule (the organ of equilibrium). Proper functioning of the sensory hair cells depends on the ionic composition of endolymph and perilymph. Whereas perilymph resembles most other interstitial fluids in containing low K+ and high Na+, endolymph has an ionic composition characterized by high K+ and low Na+, similar to the intracellular fluid (13). K+ is central to the inner ear physiology, as it is the charge-carrying ion for the sensory transduction. In the cochlea, K+ is secreted by the marginal cells of the stria vascularis to maintain a very high concentration (150 mM) in the endolymph, the extracellular fluid bathing the stereocilia of the sensory hair cells. This results in a positive potential (+90 mV), which provides a large driving force for K+ entry into the sensory hair cell. The unique ionic composition of endolymph, along with a highly positive endocochlear potential, are thus essential to mechanoelectric transduction (by hair cells) and to normal hearing (46).
Maintenance of both the ionic composition of endolymph and the endocochlear potential depends on the activity of Na,K-ATPase (5, 6). The Na,K-ATPase is an ubiquitous enzyme consisting of an
The mammalian FXYD family contains seven members that share a common signature sequence encompassing the transmembrane and adjacent regions (12). Most characterized FXYD proteins exhibit a similar structure with a single transmembrane domain and a type I orientation that is achieved, in some but not all cases, by the cleavage of an N-terminal signal peptide (for references, see Ref. 10). So far, six of the seven members of the FXYD protein family have been shown to regulate Na,K-ATPase in a tissue- and isozyme-specific way. Four FXYD proteins (FXYD1, FXYD3, FXYD4, and FXYD7) affect, in a distinct way, the apparent affinity for extracellular K+ of the Na,K-ATPase, which in the case of the brain-specific FXYD7 may be physiologically relevant in neuronal excitability (13). In addition, FXYD1 (phospholemman) (14), FXYD2 ( Given the key role of the Na,K-ATPase in the maintenance of the electrochemical composition of the endolymph and the modulatory role of FXYD proteins on its transport properties, we have looked in this study for the expression of several FXYD proteins in the inner ear. The only FXYD protein that we were able to detect by Western blot was FXYD6. We, therefore, characterized FXYD6, the last member of the FXYD family of unknown function. FXYD6, also known as phosphohippolin, was previously identified as a phospholemman-like protein expressed at high levels in brain and at a lesser level in lung, testis, and colon (21). In this study, we investigated the association of FXYD6 with Na,K- and H,K-ATPases, the modulation of Na,K-ATPase function, and its cellular distribution in the inner ear and in PC12 cells. Our results show that FXYD6 has functional characteristics that are distinct from other FXYD proteins and that the protein may have a crucial role in endolymph homeostasis.
cDNAsMouse FXYD6 cDNA, subcloned between the 5' and 3' domains of Xenopus -globin, was kindly provided by H. Garty (Weizmann Institute of Science). Cloning of rat Na,K-ATPase 1, 2, 3, 1, and 2 cDNAs has been described previously (9). cDNAs for the rabbit gastric H,K-ATPase - and -subunits were kindly provided by G. Sachs (UCLA) and cDNA for rat colonic H,K-ATPase -subunits by Fréderic Jaisser (INSERM, U478, Paris, France). All cDNAs were introduced into the pSD5 vector, and cRNAs were prepared by in vitro translation (22).
Protein Expression in Xenopus laevis OocytesStages V and VI oocytes were obtained from X. laevis as described previously (23). cRNAs coding for mouse FXYD6, rat Na,K-ATPase Preparation of Extracts of Rat Inner EarRat cochleae were isolated and ground in a mortar. The tissue was homogenized manually in a phosphate-buffered saline (pH 7.4) containing antiproteases (Roche Applied Science). The homogenate was diluted 1:1 with a lysis buffer containing 200 mM NaCl, 2% digitonin, 10 mM phenylmethylsulfonyl fluoride, 10 mM EDTA, 40 mM Tris-HCl, pH 7.4, for 1 h at 4°C and centrifuged at 10,000 x g for 5 min. The supernatants were used for immunoprecipitation and Western blotting. Antibodies, Immunoprecipitation, and Western BlottingA polyclonal FXYD6 antibody directed against a C-terminal glutathione S-transferase fusion peptide of mouse FXYD6 (62-CSFNQKPRAPGDEEAQVENLITTNAAEPQKAEN) was produced by Pascal Béguin. The corresponding cDNA region was cloned in-frame into the pGEX-4T1 vector. After purification using glutathione beads and dialysis against phosphate-buffered saline (PBS),2 the fusion protein was used for the immunization of rabbits (Cocalico Biologicals). This antibody was used for co-immunoprecipitation experiments of metabolically labeled Na,K- and H,K-ATPase expressed in Xenopus oocytes under non-denaturing conditions (24). Immunoprecipitates were resolved on 513% SDS-polyacrylamide gels or SDS-Tricine gels and revealed by fluorography. FXYD1 (14), FXYD2 (16), FXYD3 (18), FXYD4 (19), FXYD6, and FXYD7 (13) antibodies were used in Western blots to test the expression of FXYD proteins in the inner ear.
To demonstrate the association of FXYD6 with Na,K-ATPase in rat cochlea, 50 µg of the protein of cochlear extracts were incubated with a Na,K-ATPase
ElectrophysiologyElectrophysiological measurements were performed 3 days after oocyte injection with rat Na,K-ATPase
Immunocytochemistry of FXYD6The rats were deeply anesthetized and then fixed intra-aortically with 4% paraformaldehyde in 0.1 M phosphate buffer, pH 7.4. Cochleae were dissected, the oval and round windows were opened, and a hole was drilled at the apex before an overnight post-fixation at 4 °C. Cochleae were then transferred to a phosphate buffer containing 20% sucrose for cryoprotection and frozen. Fourteen-micrometer-thick sections were cut with a Reichert-Jung 2800 cryostat microtome and stored at -20 °C until use. The immunohistochemical procedures were similar to those described previously (27). The sections were rinsed (35 min) in PBS, preincubated 1 h in 30% normal goat serum with 0.3% Triton X-100, and incubated overnight at 4 °C with FXYD6 (1:500), Na,K-ATPase
PC12 Cell CultureRat pheochromocytoma (PC12) cells (kindly provided by Bernard Thorens, CIG, Lausanne, Switzerland), a cell model commonly used to study neurite formation, were maintained in 100-mm2 culture dishes in Dulbecco's modified Eagle's medium (Invitrogen) supplemented with 6% horse serum, 6% fetal bovine serum, 20 mM Hepes, 2 mM glutamine, 1 mM sodium-pyruvate, and 100 µg/ml penicillin/streptomycin at 37 °C, 5% CO2. To induce differentiation, culture medium was supplemented with nerve growth factor (10 µg/ml) for 1 week. For immunocytochemistry, cells were plated at 4 x 105 cells/well on 6-well glass slides. All samples were washed in PBS, fixed in 4% paraformaldehyde for 10 min, and rinsed with PBS. Cells were permeabilized using 0.3% Triton X-100, rinsed with PBS, and blocked with 3% bovine serum albumin in PBS for 1 h. Cells were then co-incubated with an FXYD6 antibody and Na,K-ATPase
Location of FXYD6 in the Cochlea and Interaction with Na,K-ATPase in SituPreviously, expression of several FXYD RNAs has been reported in the inner ear of mice (29, 30). We performed Western blot analysis, which revealed that, of 6 FXYD proteins tested, only FXYD6 could be detected in extracts of rat inner ear (Fig. 1A). FXYD6 expression was low at developmental stage P0 but increased at P12 and P30 (Fig. 1A, lanes 1719; Fig. 1B). FXYD6 was revealed as a doublet with a major band at 20 kDa corresponding to the molecular mass of FXYD6 expressed in brain (21) and a minor band at 18 kDa of unknown origin.
The cellular localization of the FXYD6 protein in the cochlea was investigated by immunohistochemistry. In the adult rat cochlea, FXYD6 was expressed in various epithelia bordering the endolymph (the interdental cell, the outer sulcus cells and their root process, and the stria vascularis) (Fig. 1C, green). Moreover, the protein was expressed in somas and dendrites of the spiral ganglion neurons. FXYD6 co-localized with Na,K-ATPase (Fig. 1C, red and merged) in several regions including the stria vascularis. A Na,K-ATPase -subunit antibody was able to co-immunoprecipitate FXYD6 in the inner ear at developmental stages P0 and P12 (Fig. 1D), indicating that FXYD6 is associated with Na,K-ATPase.
Location of FXYD6 in the Stria VascularisFXYD6 is expressed in the stria vascularis where it co-localizes with Na,K-ATPase (Fig. 2A). A strong signal was diffusely detected in the middle part of the stria vascularis where basolateral membranes of marginal cells and apical membranes of intermediate cells are localized (see Fig. 6). The resolution of confocal microscopic analysis was not sufficient to precisely determine the localization of FXYD6, because the basolateral membrane of marginal cells and the apical membrane of intermediate cells are associated in close vicinity of
Subcellular Localization of FXYD6 in PC12 CellsIn addition to brain, Kadowaki et al. (21) have shown that FXYD6 is expressed in non-differentiated pheochromocytoma (PC12) cells. To verify whether FXYD6 co-localizes with Na,K-ATPase in these cells, we performed co-immunostaining with FXYD6 and Na,K-ATPase antibodies, which revealed co-localization of FXYD6 and Na,K-ATPase at the plasma membrane of non-differentiated PC12 cells (Fig. 3A, upper panels). Moreover, in differentiated PC12 cells of neuronal phenotype, FXYD6 colocalized with Na,K-ATPase in dendrites and the cell body (Fig. 3A, lower panels). Both in non-differentiated (Fig. 3B, left panel) and differentiated (Fig. 3B, right panel) PC12 cells, FXYD6 was associated with Na,K-ATPase, because it could be co-immunoprecipitated with a Na,K-ATPase
Association of FXYD6 with Na,K-ATPase and H,K-ATPase in Xenopus OocytesThe association of FXYD6 with Na,K-ATPase was investigated after co-expression of FXYD6 in Xenopus oocytes together with Na,K-ATPase 1- 1, 2- 1, 3- 1, or 1- 2 isozymes. After metabolic labeling and various pulse-chase periods, microsomes were prepared and subjected to immunoprecipitations under nondenaturing conditions with an FXYD6 antibody. The FXYD6 antibody immunoprecipitated the 20-kDa form of FXYD6 (Fig. 4A). The intensity of the FXYD6 band was intrinsically low, because FXYD6 contains only 1 methionine, which can be metabolically labeled. Western blot analysis confirmed the efficient expression of FXYD6 and also revealed the 18-kDa form of FXYD6 observed in the inner ear (data not shown). Na,K-ATPase - and -subunits of all - 1 isozymes could be co-immunoprecipitated with FXYD6 after the pulse and prolonged chase periods (Fig. 4A, lanes 121). Moreover, FXYD6 antibodies co-immunoprecipitated Na,K-ATPase 1- 2 isozymes (Fig. 4B, lanes 16), which is the prominent Na,K-ATPase isozyme in the stria vascularis (34). Similar experiments were performed with gastric and non-gastric H,K-ATPase, and they showed that both H,K-ATPases co-expressed with FXYD6 could be co-immunoprecipitated with the FXYD6 antibody over prolonged chase periods (Fig. 4C).
Functional Effects of FXYD6 on Na,K-ATPase Transport PropertiesThe functional effects of FXYD6 on Na,K-ATPase transport properties were investigated by electrophysiological measurements in Xenopus oocytes expressing rat Na,K-ATPase 1- 1 or 1- 2 isozymes with or without FXYD6.
As shown in Fig. 5A, Na,K-ATPase
In this paper, we provide evidence that FXYD6, the last uncharacterized FXYD protein, may also be a tissue-specific regulator of Na,K-ATPase, similar to other members of the FXYD protein family. Indeed, our results show that FXYD6 is associated with Na,K-ATPase in the inner ear and that it modifies the transport properties of different Na,K-ATPase isozymes after co-expression in Xenopus oocytes. Expression of FXYD6 in the Inner EarRNA expression of several members of the FXYD family in the inner ear has been reported previously (29, 30). In this study, we show that, of 6 FXYD proteins, only FXYD6 was detected in this organ at the protein level. Thus, the other FXYD proteins are either not expressed or at much lower levels than FXYD6.
Interaction of FXYD6 with P-Type ATPasesA common feature of all FXYD proteins so far characterized is their interaction with Na,K-ATPase, both in expression systems and in situ (for review, see Refs. 10 and 11). FXYD6 shares this property but shows a broader specificity than other FXYD proteins. Similar to mouse FXYD3 (18), FXYD6 stably interacts also with both gastric and non-gastric H,K-ATPases after expression in Xenopus oocytes. In the cochlea, FXYD6 is localized in neurons and, interestingly, in the stria vascularis, which co-expresses Na,K-ATPase and gastric H,K-ATPase at the basolateral side of marginal cells (28) (Fig. 6). Further experiments are needed to confirm the potential association of FXYD6 and H,K-ATPase in this organ.
Putative Physiological Relevance of the Regulation of Na,K-ATPase by FXYD6 in the Maintenance of the Endolymph Electrochemical CompositionCompared with other FXYD proteins studied, association of FXYD6 modulates the transport properties of Na,K-ATPase in a distinct way. In view of the cellular localization of FXYD6 in the cochlea, we could predict at least two sites of action, which preferentially express either Na,K-ATPase 1- 1 or 1- 2 isozymes. Interestingly, our study shows that these two rat Na,K-ATPase isozymes have different functional properties (Fig. 5A). These results confirm our previous observation that isoforms can differentially modulate the transport properties of Na,K-ATPase (9, 25).
The first site of action of FXYD6 might be the auditory neurons, mainly expressing Na,K-ATPase
The second site of action of FXYD6 might be the stria vascularis. The stria vascularis is made up of three layers of cells, epithelial marginal cells, intermediate cells, and epithelial basal cells (Fig. 6). Marginal cells interdigitate with intermediate cells and are separated by the intrastrial space. K+ coming from the spiral ligament enter basal cells and intermediate cells via a dense network of gap junctions. Thereafter, it is secreted into the intrastrial space by potassium channels and taken up by marginal cells via Na,K-ATPase and other K+ transporters, e.g. H,K-ATPase. Finally, K+ is secreted into the scala media to form the endolymph. FXYD6 is strongly expressed in the marginal cells and possibly in the intermediate cells, which mainly express
The intrastrial space is critical for the generation of the endocochlear potential. Indeed, the endocochlear potential is essentially a K+ equilibrium potential that is generated by the conjunction of two K+ channels, Kcnj10 (Kir 4.1) and MERG1a located in the intermediate cells of the stria vascularis in conjunction with the very low K+ concentration in the intrastrial fluid and a normally high K+ concentration in the cytosol of intermediate cells (3739). Intermediate cells might act as glial cells in siphoning the extracellular K+ (40). Na,K-ATPase and, as suggested by Nie et al. (39), Kcnj10 may be implicated in this process, which would permit the secretion of K+ by the MERG1a channel. At 1 mM K+ in the intrastrial space (37), the In conclusion, in this study, we have characterized the last FXYD protein of unknown function. Our results show that FXYD6 associates with Na,K-ATPase as other FXYD proteins and has a distinct functional effect on Na,K-ATPase, indicating that all mammalian FXYD proteins associate with and modulate the transport properties of Na,K-ATPase in a tissue-specific way. The localization of FXYD6 in the inner ear suggests an important role in endolymph production.
* This study was supported by Grant 3100A0-107513 (to K. G.) from the Swiss National Science Foundation. The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. 1 To whom correspondence should be addressed: Department of Pharmacology and Toxicology, University of Lausanne, Rue du Bugnon 27, 1005 Lausanne, Switzerland. Tel.: 41-21-692-54-10; Fax: 41-21-692-53-55; E-mail: Kaethi.Geering{at}unil.ch.
2 The abbreviation used is: PBS, phosphate-buffered saline.
We thank Stéphanie Bibert and Jean-Daniel Horisberger for helpful discussion in the preparation of the manuscript. We also thank the Cellular Imaging Facility of the University of Lausanne, which permitted us to realize immunohistochemistry acquisitions. Anti-barttin antibody was kindly provided by Dr. Shinichi Uchida (Tokyo Medical and Dental University).
This article has been cited by other articles:
|
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Advertisement | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||