|
Advertisement | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
J. Biol. Chem., Vol. 282, Issue 24, 17351-17362, June 15, 2007
Mitotic Phosphorylation of the Anaphase-promoting Complex Inhibitory Subunit Mnd2 Is Necessary for Efficient Progression through Meiosis I*![]() ![]() 1
From the
Received for publication, November 24, 2006 , and in revised form, April 13, 2007.
The yeast anaphase-promoting complex (APC) subunit Mnd2 is necessary for maintaining sister chromatid cohesion in prophase I of meiosis by inhibiting premature ubiquitination and subsequent degradation of substrates by the APCAma1 ubiquitin ligase. In a proteomics screen for post-translational modifications on the APC, we discovered that Mnd2 is phosphorylated during mitosis in a cell cycle-dependent manner. We identified and characterized the sites of mitotic Mnd2 phosphorylation during the cell cycle. Collective mutation of Mnd2 phosphorylation sites to alanine had no effect on vegetative growth but a striking effect (>85% reduction) on the percentage of tetrad-forming cells compared with the wild type strain. Similar to the MND2 deletion strain, cells harboring the alanine mutant that did not form spores arrested after premeiotic S phase with a single undivided nucleus and low levels of the APCAma1 meiotic substrate, Clb5, relative to wild type cells. In contrast, collective mutation of Mnd2 phosphorylation sites to aspartic acid resulted in partial suppression of the sporulation defect. No differences were observed in the binding between each Mnd2 isoform and the APC in vitro. However, in vivo, we observed a gradient in the abundance of APC-associated Mnd2 in each strain that was proportional to the observed differences in sporulation and Clb5 levels. Taken together, these data suggest that mitotic phosphorylation of Mnd2 is necessary for APC-mediated progression beyond the first meiotic nuclear division.
Proper progression through the eukaryotic cell cycle is achieved in large part through coordinated regulation of protein degradation mediated by E32 ubiquitin ligases (for a review, see Refs. 14). During mitosis and meiosis, targeted protein degradation is tightly associated with the organization of chromosomes and their equivalent distribution into two separate progeny cells during anaphase and is controlled by a multisubunit ubiquitin ligase called the anaphase-promoting complex (APC) (57). As an E3 ligase, the APC transfers ubiquitin onto lysine residues of substrate proteins in an iterative manner that forms polyubiquitin chains on the surface of a substrate protein (8, 9). The polyubiquitinated substrate is then recognized by the 26 S proteosome and degraded, while the ubiquitin is recycled. The APC is itself regulated, ensuring that the timing of substrate degradation is tied to the completion of other cellular processes. Indeed misregulation of the APC can lead to disastrous results including cell cycle arrest or improper chromosome segregation and cell death (1012).
Regulation of the APC during mitosis is accomplished by several mechanisms, including the association of co-activator proteins and through phosphorylation of individual subunits within the complex. Two co-activator proteins, Cdc20 and Cdh1, facilitate the association of substrate proteins with the APC at different stages of the mitotic cell cycle (1317). Each co-activator is regulated through mechanisms involving both phosphorylation and protein-protein interactions (1521). Additionally specific subunits of the APC are phosphorylated in a cell cycle-dependent manner, which has been shown to enhance binding and activation by Cdc20 (2224). APC subunit phosphorylation is controlled in large part by mitotic cyclin-dependent kinase activated by the Clb2 cyclin, which is later targeted for destruction by the APC upon exit from mitosis (25, 26). As a result, the APC exists in a hyperphosphorylated state during mitosis and a hypophosphorylated state during G1 phase. Mutation of the cyclin-dependent kinase consensus sites in the APC subunits Cdc16, Cdc27, and Cdc23 results in reduced APCCdc20 activity toward Clb2 in vivo as well as a delay in the onset of anaphase (25, 26). Currently there is no evidence that mutation of known mitotic APC phosphorylation sites will have detrimental effects on meiotic cell cycle transitions. In budding yeast the APC is regulated during meiosis not only by Cdc20 and Cdh1 co-activators but also by a meiosis-specific co-activator called Ama1 (27, 28), which is necessary for spore wall assembly and expression of late meiotic genes (29). AMA1 gene transcription and splicing occurs only in meiotic cells (29) and begins during premeiotic S phase (30). However, the co-activator is selectively inhibited early in meiosis by the APC subunit Mnd2 (30, 31). Mnd2 is found in complex with the APC during both the mitotic and meiotic cell cycles (3234). Yeast lacking Mnd2 proceed normally through the mitotic cell cycle but are unable to complete sporulation, arresting before the first meiotic nuclear division with uncondensed chromatin (35). Recent evidence has shown that Mnd2 specifically inhibits APC activation by Ama1 during prophase I. In cells lacking Mnd2, uninhibited APCAma1 prematurely targets securin (Pds1) for degradation, which results in the premature separation of sister chromatids due to unrestrained separase (Esp1) activity (30), followed by cell cycle arrest. Uninhibited APCAma1 was also found to control the degradation of Clb5 during meiosis. Although inhibited early in meiosis, APCAma1 becomes active during anaphase I despite the presence of Mnd2, suggesting that the inhibitory function of Mnd2 is regulated post-translationally. Furthermore it has been suggested that regulation of Mnd2 might be linked to its phosphorylation status (30). In a screen for cell cycle-dependent post-translational modifications that occur on the APC during mitosis, we discovered that Mnd2 is one of five major phosphorylated subunits in the complex. Here we show the identity of Mnd2 phosphorylation sites and their relative changes during the cell cycle using mass spectrometry. To determine the functional significance of Mnd2 phosphorylation, we used site-directed mutagenesis to generate yeast strains harboring Mnd2 phosphorylation site mutants and then tested these mutants for their ability to progress through mitosis or meiosis. Vegetative growth of mnd2 phosphorylation site mutants was unperturbed. However, sporulation of a mnd2-(S/T-A) strain was severely compromised, whereas reciprocal mutation to aspartic acid partially suppressed the sporulation defect. The defects in sporulation of the alanine mutant were consistent with those of the deletion strain, including arrest before the first meiotic nuclear division and reduced ability to accumulate Clb5. The sporulation defect of the alanine mutant strain can be explained by the relatively low levels of mnd2-(S/T-A) found in APC co-precipitations compared with the aspartic acid mutant and wild type Mnd2 isoforms in vivo. However, in vitro binding between the APC and each Mnd2 isoform was found to be almost identical, and treatment of the APC with phosphatase did not eliminate Mnd2 co-precipitation, suggesting that phosphorylation may be necessary to maintain the stability of Mnd2 before entry into meiosis. Taken together, these data support a role for mitotic phosphorylation in the regulation of Mnd2 as an APCAma1 inhibitor in early meiosis.
Plasmid and Strain ConstructionStandard methods for the growth, maintenance, and transformation of yeast and bacteria and for the manipulation of DNA were used. All constructed plasmids were verified by DNA sequencing. Yeast strains used in this study are listed in Table 1. Strain W1588-4c is a derivative of W303 in which the weak rad5 mutation has been repaired (36). Strains expressing Cdc27 and Mnd2 with C-terminal 3x FLAG epitopes were constructed by integrating PCR amplicons amplified from p3FLAG-KanMX plasmid (a gift from Dr. Toshio Ysukiyama, Fred Hutchinson Cancer Center) into the yeast genome as described previously (37). The Apc1-TAP strain was generated by integration of PCR amplicons from pBS1539 as described previously (38). Construction of phosphorylation site mutations in MND2 was accomplished using the QuikChange multisite-directed mutagenesis kit (Stratagene) according to the manufacturer's specifications (oligonucleotide sequences are available upon request). Mutations were made and sequenced in pIVEX-FLAG-MND2 in which the MND2 open reading frame was originally cloned into the NotI/SalI sites (34). After mutagenesis, the XhoI fragment from pIVEX-FLAG-MND2 or pIVEX-FLAG-mnd2 phosphorylation site mutant (containing all 14 mutations within the last 702 base pairs of the open reading frame) was subcloned into the XhoI site of pMT004, a pRS404 vector containing the first 405 base pairs of the MND2 open reading frame (up to the naturally existing XhoI site) and 500 base pairs of the upstream promoter region. The resulting wild type, S/T-A mutant, and S/T-D mutant plasmids were linearized with HindIII and integrated into the trp locus of YKA311 in which the open reading frame for MND2 in the high efficiency sporulating yeast strain RSY333 was replaced with KanMX4 by PCR-mediated transformation (29). Diploid strains were created by transformation with YCp50::HO (HO mothallic switching endonuclease) and selecting for transformants on synthetic dextrose lacking uracil (SD-URA). Successful conversion to diploid was confirmed by flow cytometry.
Cell Cycle ArrestsTo arrest cells in G1 phase, cultures were first grown for two generations in YPD medium as measured by absorbance at 600 nm (corresponding to growth from A600 = 0.20.8) followed by addition of synthetic -factor peptide (University of North Carolina peptide synthesis facility) to a final concentration of 50 µg/liter. For M phase arrests in the temperature-sensitive strain YKA156, cells were grown for two generations at the permissive temperature (27 °C) and arrested by shifting the temperature to 37 °C, which results in late M phase arrest (3941). The degree of cell cycle arrest was monitored by phase-contrast microscopy, and cells were harvested by centrifugation after >90% of the culture reached the desired morphology (unbudded for G1 arrest and equivalently budded for M arrest). Harvested cells were washed once with deionized water, centrifuged once more, and frozen at 80 °C overnight prior to protein purification.
Affinity Purifications and Phosphatase AssaysYeast cells were lysed at 4 °C in prechilled lysis buffer containing 25 mM HEPES-NaOH, pH 7.5 (Fisher), 400 mM NaCl (Sigma), 10% glycerol (Fisher), 0.5 mM dithiothreitol (Sigma), 0.1% Triton X-100 (Sigma), 50 mM NaF (Sigma), 1.3 mM activated sodium ortho-vanadate (Sigma), 50 mM
Phosphatase assays on full-length protein were conducted on the APC directly bound to the affinity matrix after washing with detergent-free sodium phosphate buffer. The affinity matrix was first conditioned 4 x 7 min with 1 ml of phosphatase buffer containing 50 mM Tris-HCl, pH 7.5, 0.1 mM EDTA, 2 mM MnCl2. Next the matrix was split, and one-half was treated with 1000 units of GST Fusion ProteinMND2 wild type, S/T-A, or S/T-D genes were subcloned into pGEX-4T1 by PCR from the pRS404 vectors harboring each gene isoform. The resulting N-terminal GST fusion constructs were overexpressed in BL21 pLysS cells according to the manufacturer's protocol (Stratagene). Cells were lysed by sonication in 1x phosphate-buffered saline and cleared by centrifugation. GST fusion proteins were purified from the cell lysate by batch incubation with glutathione-SepharoseTM 4B (Amersham Biosciences). Each GST fusion protein was digested with trypsin to verify length and sequence by MALDI-time of flight (TOF) MS. ChromatographyFull-length APC subunits eluted from the affinity matrix were fractionated by reverse-phase HPLC using an Agilent 1100 series HPLC instrument coupled to a C4 Mass Spec reverse-phase column (Vydac), an 1100 series UV spectrophotometer (Agilent), and a Foxy 200 fraction collector (ISCO Inc.). Conditions for HPLC separation were as follows: buffer A, 5% acetonitrile (ACN), 0.1% trifluoroacetic acid; buffer B, 95% ACN, 0.09% trifluoroacetic acid; gradient, 5% B for 5 min, 565% B in 65 min, and 65-95% B in 10 min. Fractions were collected every minute, frozen at 80 °C, and lyophilized. In-gel digestion with porcine trypsin was conducted as described previously (43). Separation of tryptic peptides was accomplished by capillary HPLC using an Agilent 1100 series capillary liquid chromatography system with PepMap C18 column (LC Packings) connected in line with a Probot MALDI target microfraction collector (LC Packings) (44).
Mass SpectrometryLyophilized C4 HPLC fractions containing full-length Mnd2 were reconstituted in 5 µl of 85% ACN, 0.1% trifluoroacetic acid, and one-tenth of the sample was prepared for MALDI-TOF MS by the dried droplet method with a saturated solution of sinapic acid (Fluka) in 50% ACN, 0.1% trifluoroacetic acid. The reconstituted sample was then analyzed directly on a Reflex III MALDI-TOF mass spectrometer (Bruker Daltonics Inc.) operating in linear mode. Linear mode MALDI-TOF mass spectra were obtained immediately after calibrating the mass spectrometer using a mixture of bovine serum albumin (Sigma) and cytochrome c (Sigma) that was spotted in close proximity to the sample. Liquid chromatography microfractions were analyzed on an ABI 4700 MALDI-TOF/TOF mass spectrometer (Applied Biosystems Inc.) using a saturated solution of recrystallized
In Vivo 32P LabelingYeast strains were labeled with monosodium [32P]phosphate in vivo as described previously (26). Briefly saturated overnight 5-ml cultures were diluted to A600 = 0.2 in 50 ml of YPD and allowed to grow to A600 = 0.6 at which time Me2SO was added to 1%. At A600 = 0.8, each culture was arrested in M phase by addition of nocodazole to 15 µg/ml or in G1 phase by addition of Cells were lysed by adding cell pellet-equivalent volumes of lysis buffer and 0.5-mm glass beads to the pellet and vortexing 6 x 2 min at maximum power with 5-min rest intervals on ice. All following steps were conducted at 4 °C. The extract was cleared by centrifugation in a microcentrifuge at 16,100 x g for 20 min, and the supernatant was transferred to a fresh 2-ml screw cap tube followed by affinity purification as described above. The APC was eluted as described above and then precipitated to remove excess volume and salt by adding 10 volumes of cold acetone and incubating at 20 °C overnight. The precipitate was collected by centrifugation at 16,100 x g for 20 min, air-dried at room temperature, and then resuspended in 1x lithium dodecyl sulfate loading buffer (Invitrogen Inc.) containing 100 mM dithiothreitol. The sample was separated on a precast 412% BisTris acrylamide gel (Invitrogen), dried, and exposed to a storage phosphor screen for analysis by PhosphorImager (Storm, Amersham Biosciences).
Growth Curves, Sporulation Assays, and Western BlottingTo measure relative growth rates of strains harboring mnd2 phosphorylation site mutants or complete open reading frame deletions, saturated overnight cultures grown in YPD medium were diluted 20-fold into 5 ml of fresh YPD medium and grown for To induce sporulation, single colonies picked from YP-glycerol agar plates were spread over the entire surface of a fresh YPD agar plate and grown for 24 h at 30 °C, ensuring that overnight growth saturated the YPD plate. All following steps were conducted at 30 °C. The YPD plates were replica-plated to presporulation agar plates (1% potassium acetate, 1% yeast extract, 2% peptone) until >95% of the cell population were unbudded (2324 h) as counted using a hemacytometer followed by replica-plating to sporulation medium (SPM) agar plates (1% potassium acetate, 0.1% yeast extract, 0.05% dextrose). The percentage of tetrads was monitored by light microscopy using a hemacytometer. Cells were collected by gently scraping a fraction of the cells followed by resuspension in water, centrifugation, snap freezing the pellet in a dry ice/ethanol bath, and storage at 80 °C (for Western blots). Additionally an aliquot of the scraped cells was resuspended in 70% ethanol (for fluorescence-activated cell sorting or fluorescence microscopy).
Protein levels were analyzed by Western blotting after breaking cells with glass beads in trichloroacetic acid lysis buffer (10 mM Tris-HCl, pH 8.0, 25 mM ammonium acetate, 1 mM Na2EDTA, 10% trichloroacetic acid). The trichloroacetic acid-precipitated protein pellet was dissolved in resuspension solution (3% SDS, 100 mM Tris-HCl, pH 11.0), and the total protein concentration of each sample was quantified by absorbance at 750 nm using a DC protein assay kit (Bio-Rad). For normalized comparison, 40 µg of total protein was loaded in each lane. Primary antibodies to Clb5 (Santa Cruz Biotechnology sc-20170; 1:1000) or custom rabbit Mnd2 N terminus antibodies ( Fluorescence Microscopy and Flow CytometryCells fixed in 70% ethanol were harvested by centrifugation, washed twice, and resuspended in 1x phosphate-buffered saline at 25 °C. Approximately 10 µl of the cell suspension was adsorbed onto a poly(L-lysine) glass microscope slide for 5 min after which the excess suspension was removed and replaced with 10 µl of DAPI solution (2 µg/ml) for 5 min. After removal of the excess DAPI solution, each sample was washed twice for 2 min with 30 µl of 1x phosphate-buffered saline and allowed to dry at room temperature. Finally 10 µl of mounting solution (90% glycerol, 1 mg/ml p-phenylenediamine, 20 ng/ml DAPI) was added to the top of each sample, covered with a coverslip, and compressed with weight for at least 1 h. Cells were imaged by differential interference contrast or by fluorescence detection of DAPI-stained nuclei. Measurements of cellular DNA content were collected on a FACScan flow cytometer as described previously (34).
Mnd2 Is Hyperphosphorylated in Vivo during MitosisRecent mass spectrometric analyses have shown that at least five of 11 different human APC subunits are phosphorylated on a total of 43 different Ser or Thr residues, many of which are differentially phosphorylated in a cell cycle-dependent manner (45). In comparison, only three of 13 APC subunits in yeast have been shown to be phosphorylated in vivo (25, 26), and although specific sites have been inferred from canonical cyclin-dependent kinase consensus sequences, there has not been a focused proteomics scale analysis of APC subunits thus far. Therefore, to reveal the presence of previously unknown post-translational modifications on the APC (including phosphorylation), we measured the full-length molecular weights of individual APC subunits by MALDI-TOF MS and compared these measurements to the calculated masses of each subunit based on sequence information found in the Saccharomyces Genome Database (www.yeastgenome.org/). When conducting these analyses with APC purified from yeast arrested in M phase with nocodazole we discovered a 392-Da positive shift (m/z 43,217) in the apex mass of the subunit Mnd2 with respect to the calculated molecular mass (munmodified = 42,825 Da), suggesting that Mnd2 was post-translationally modified in M phase. We repeated this experiment with cells arrested in G1 phase and found only a modest positive mass shift of 94 Da (m/z 42,919) relative to the calculated molecular weight (Fig. 1A). The mass deviation of Mnd2 between G1 and M phases (m/zG1 m/zM = 298) was the largest of any subunit we measured (data not shown) and suggested that the modification was cell cycle-dependent. Next we determined whether Mnd2 could be metabolically labeled with NaH 322PO4 in yeast arrested in M phase with nocodazole or in G1 with -factor. A comparison of FLAG affinity purifications from metabolically labeled yeast with or without a C-terminal 3x FLAG tag on the APC subunit Cdc27 is shown (Fig. 1B). Similar to previous reports, APC subunit phosphorylation was much higher in M phase compared with G1 phase. In nocodazole-arrested cells, we observed six distinct bands unique to the tagged strain that did not appear in the purification from a strain lacking a 3x FLAG tag. Alignment of the phosphorimage with a Coomassie-stained large scale purification of the APC from nocodazole-arrested cells revealed the identity of the known phosphorylated subunits Cdc16, Cdc27, and Cdc23. In addition, we observed phosphoproteins that aligned with Apc1, Apc2, and Mnd2. To verify the identity of these three phosphoproteins, we introduced epitope tags onto the C termini of Apc1 (Apc1-TAP in Cdc27-3x FLAG background), Mnd2 (Mnd2-3x FLAG), and Apc2 (Apc2-TAP in Mnd2-3x FLAG background), which would create a gel mobility shift in the 32P-labeled phosphoprotein band in question if the identity was assigned correctly. Each tagged strain was metabolically labeled in the presence of nocodazole, and the resulting FLAG affinity purification was compared with the original Cdc27-3x FLAG 32P-labeled purification. We observed a shift in gel mobility for the phosphoproteins provisionally assigned to Apc1 and Mnd2 (Fig. 1C). However, no shift was observed for the band assigned to Apc2 (data not shown).
To determine whether the apex mass shift observed between the Mnd2 MALDI mass spectra was completely or partially due to phosphorylation and to estimate the number of phosphorylation sites involved, we compared the full-length molecular weights of Mnd2 in M phase by MALDI-TOF MS before and after treatment with -phosphatase. Nocodazole induces a mitotic checkpoint arrest by inhibiting microtubule polymerization, which may induce phosphorylation of proteins that would not normally be phosphorylated during an unperturbed mitotic progression. Therefore, in this experiment, we opted to use a strain that harbors a temperature-sensitive mutation in the mitotic exit network kinase Cdc15. We have used this strain successfully in the past to characterize phosphorylation of the APC co-activator Cdh1 (46). APC purifications from yeast arrested in G1 or M phase cells were split, and half of each purification was treated with -phosphatase. The apex mass of Mnd2 from M phase cells was 43,221 Da before phosphatase treatment and shifted to a mass of 42,837 Da after phosphatase treatment; this is within 12 Da of the calculated mass of the unmodified protein and indicated that the entire mass shift observed in M phase is due to phosphorylation (Fig. 1D). In comparison, the apex mass of Mnd2 from G1 phase cells was 42,926 Da before phosphatase treatment and was shifted to 42,825 Da after phosphatase treatment, indicating that Mnd2 is less phosphorylated during G1 phase compared with M phase. Dividing the average mass difference between the measurements made before and after phosphatase treatment ( m = mp mdp) by the mass of a single phosphorylation modification (HPO3 = 80 Da) indicated that Mnd2 was phosphorylated on at least four to five different sites (384 ÷ 80 Da) during M phase and only one site on average (101 ÷ 80 Da) during G1 phase. Furthermore the 283-Da mass difference observed between the modified states of Mnd2 measured in the phosphatase assay corresponded very well with the measured mass difference of 298 Da determined with Mnd2 purified from nocodazole-arrested cells. Although these data indicate a specific number of phosphate modifications on Mnd2, it has been our experience that these values are usually underestimates of the total number of phosphorylation sites of a protein possibly due to modification site heterogeneity and also due to the resolution of MALDI-TOF MS in the linear mode. Attempts to measure the intact protein mass by electrospray ionization MS were not successful. We conclude that Apc1 and Mnd2 are phosphorylated subunits of the budding yeast APC. We further conclude that Mnd2 phosphorylation is cell cycle-dependent. Characterization of Mitotic Mnd2 Phosphorylation SitesWe used a combination of MS-based approaches to identify the phosphorylation sites in Mnd2 protein from M phase cells. Surprisingly tandem MS analysis of Mnd2 peptides revealed only one ion at m/z 2823.1 that could be assigned to the tryptic Mnd2 monophosphopeptide 140AQNAEGNNEEDFRQHDpSREEDPR162 where pS is phosphoserine (Fig. 2A). The tandem mass spectrum contained a number of b and y fragment ions from the Mnd2 peptide including some in which there was a distinct neutral loss of phosphate (H3PO4) corresponding to a mass shift of 98 Da. We also assigned a second ion of very low intensity, m/z 1807.8, to the Mnd2 monophosphopeptide 258IVPDDLLMRPTSLSR272 (Table 2). However, the low intensity of the fragment ions did not allow us to determine which of the three possible phosphorylation sites (underlined) was occupied (data not shown). Repeating this experiment and including a G1-arrested sample for comparison, we found that phosphorylation at Ser156 occurred only during M phase (Fig. 2B). Similarly no phosphorylation was observed during G1 phase for peptide Mnd2-(258272) (data not shown).
Based on our initial MS analysis, we could assign peptides to 70% of the Mnd2 sequence by mass fingerprinting and tandem MS but found only two phosphorylation sites. The remaining 30% of Mnd2 sequence included two theoretical tryptic peptides, 170VILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQR255 (m/z 9525), and 287NPYDIDSDNDGEDSK301 (m/z 1683.6), that contain a total of 10 potential serine or threonine phosphorylation sites. We did not detect the peptide Mnd2-(287301) (including hypothetically post-translationally modified forms) in our initial MS analysis, although its theoretical mass falls between the optimal range of detection for reflectron mode MALDI-TOF MS, which is between m/z 800 and 4000. We made this observation more than once during repeat experiments with Mnd2 from M phase cells (data not shown). We suspected that the difficulty in detecting peptides within these regions of Mnd2 could be due to their high Asp/Glu content, which can affect peptide ionization in the mass spectrometer, as well as phosphorylation, which can also affect peptide ionization and inhibit tryptic digestion at cleavage sites that neighbor a phosphorylated residue. We used linear mode MALDI-TOF MS, which allows the detection of high mass protein species, to search for the large tryptic peptide Mnd2-(170255) as well as any miscleaved tryptic peptides that contained Mnd2-(287301). Using this approach, four major species of interest were detected at m/z 6618, 6688, 8393, and 9838, none of which could be assigned to the unmodified Mnd2 sequence. Comparison of the spectra with and without phosphatase treatment showed that each of the four species was phosphorylated as indicated by negative shifts in the apex mass after phosphatase treatment (Fig. 2C). Using the apex mass of the ion species after phosphatase treatment, we were able to assign each peptide to Mnd2 as well as calculate the average number of occupied phosphorylation sites within each peptide (Table 2). The tryptic peptides assigned to m/z 6618, 6688, and 8393 each contained multiple missed cleavage sites and included the tryptic region Mnd2-(287301) with one or two occupied phosphorylation sites. Because we were able to detect each of the tryptic peptides flanking the Mnd2-(287301) region in the reflectron mode MS analysis and confirm that they were unmodified, we concluded that the occupied phosphorylation sites are Ser293 and Ser300. The ion at m/z 9838 was assigned to the largest tryptic peptide, Mnd2-(170255), and contained an average of four occupied phosphorylation sites. The mass accuracy of this assignment was within 7 Da of the expected mass, likely reflecting an average of a mixture of the unmodified peptide (m/z 9519) and a monooxidized peptide (m/z 9535) because no other peptides with up to 10 missed cleavages could be closely matched to this ion. Calculation of the apex mass shift after phosphatase treatment indicated that Mnd2-(170255) contains an average of four phosphorylated sites out of eight potential serine or threonine residues. A comparison of these phosphopeptides in G1 phase showed that Mnd2 maintains partial phosphorylation (Fig. 2D). In summary, we found that Mnd2 is phosphorylated on at least eight different sites during mitosis and at least four sites during G1 phase.
Yeast Harboring Mnd2 Phosphorylation Site Mutations Grow NormallyCell cycle-dependent phosphorylation is an important component of APC-mediated cell cycle progression. Yeast strains harboring altered forms of the APC that cannot be modified by phosphorylation display growth defects associated with a delay in mitotic progression (26). To determine whether Mnd2 phosphorylation is critical to the progression of mitosis, we compared growth rates of an mnd2
Mitotic Mnd2 Phosphorylation Is Required for Progression through the First Meiotic Nuclear DivisionYeast lacking Mnd2 are incapable of sporulation and arrest after the completion of premeiotic S phase but before the first meiotic nuclear division (30, 31, 35). To determine whether Mnd2 phosphorylation is required for sporulation, we compared the phenotypes of WT, mnd2 , mnd2-(S/T-A), and mnd2-(S/T-D) strains upon induction of sporulation. When comparing the kinetics of tetrad formation for each strain, we found that 85% of WT cells formed complete tetrads within 42 h after plating to sporulation medium; this was nearly identical to the sporulation percentage for cells harboring MND2 at its natural genetic locus (Fig. 4A). In contrast, mnd2 strains were unable to form tetrads. Only 13% of cells harboring mnd2-(S/T-A) formed tetrads, whereas the percentage of tetrads increased to 42% of cells harboring mnd2-(S/T-D). In addition, as observed by light microscopy, there was no appreciable accumulation of cells containing only two spores (dyads), which would have indicated arrest between the first and second nuclear division. The differences in tetrad formation between the WT and mutant strains was not due to a failure in meiotic entry because each strain completed premeiotic S phase as measured by flow cytometry (Fig. 4B).
Quantitation of tetrad formation cannot be used as an indicator for the ability of cells to complete meiotic nuclear divisions. Indeed meiotic nuclear divisions and spore formation are not completely connected pathways, and it is possible to achieve nuclear divisions without forming spores, which has been reported for subpopulations of ama1 cells (29). Cells that do not undergo the first meiotic nuclear division arrest with a single nucleus that can be visualized using fluorescence microscopy of DAPI-stained nuclei. To determine whether meiotic nuclear divisions were compromised in the mnd2 phosphomutant strains, we scored the percentages of non-tetrad-forming (residual) cells that contained a single undivided nucleus after 48 h on sporulation medium. In strains harboring mutant or wild type Mnd2, the percentage of non-tetrad cells containing a single undivided nucleus was greater than 90% (Fig. 4C). Because tetrads are formed at low levels in strains harboring mnd2-(S/T-A), we also quantified the viability of tetrad spores. A high percentage of spore viability indicates that cells are capable of proper nuclear divisions that distribute a complete complement of the haploid genome to each spore. Low spore viability is observed when nuclear divisions are compromised such that individual spores are left with an incomplete complement of the haploid genome. Following tetrad dissection, 95% of WT spores were viable compared with 89 and 84% spore viability for mnd2-(S/T-D) and mnd2-(S/T-A) cells, respectively (Fig. 4C).
The proteins Pds1 and Clb5 fail to accumulate appreciably in sporulating mnd2
Mnd2 Phosphomutants Display Differential Co-precipitation with the APC in Vivo but Not in VitroAlthough mitotic phosphorylation of Mnd2 is necessary for progression through early meiosis, it is clearly not essential for normal cell growth, making it difficult to explain the reason why Mnd2 phosphorylation occurs during the mitotic cell cycle. Previous reports suggest that Mnd2 can only inhibit the APC when it is present on the complex (30). Therefore, one possible explanation for our results is that phosphorylation of Mnd2 affects its binding to the APC. First we compared the levels of each Mnd2 isoform after affinity purification of the APC from WT, mnd2
In contrast to our in vivo data, we found that binding between APCmnd2
We used a mass spectrometric approach to discover and identify mitotic phosphorylation sites on the APC subunit Mnd2. The phosphorylation status of Mnd2 appears to be generally similar to that of other phosphorylated yeast APC subunits (Cdc16, Cdc27, and Cdc23) in that it was higher in mitosis compared with G1 phase. Interestingly none of the phosphopeptides observed contain the canonical cyclin-dependent kinase recognition sequence (S/T)P suggesting the involvement of other kinases. Mutation of Mnd2 phosphorylation sites had no effect on mitotic cell cycle progression; this is not surprising considering that Mnd2 has no required function during vegetative cell growth. However, there was a striking difference in the ability of Mnd2 phosphorylation site mutants to complete meiosis. The similarities in sporulation defect for the alanine and deletion mutant strains strongly suggest that phosphorylation is critical for Mnd2 function early in the meiotic program. Both strains completed premeiotic S phase, and like the deletion strain, the majority of alanine mutants failed to undergo the first meiotic nuclear division. In addition to a meiotic sporulation defect, we also found that mnd2-(S/T-A) mutants have lower levels of the APCAma1 substrate, Clb5, which suggests that mitotic phosphorylation of Mnd2 is necessary to maintain its APC inhibitory function rather than an effect unrelated to APC activity. Mutation of each phosphorylation site to aspartic acid, which may mimic the phosphorylated state of Mnd2, partially suppressed the sporulation defect and further supported the conclusion that phosphorylation is necessary for Mnd2 function in early meiosis.
The difference in sporulation of strains harboring different Mnd2 isoforms does not appear to be due to a difference in binding between Mnd2 and the APC. In vitro, WT Mnd2, mnd2-(S/T-A), and mnd2-(S/T-D) are each capable of binding the APC with similar affinities. Furthermore phosphorylation of WT Mnd2 is not necessary for its association with the APC because treatment of M phase or G1 phase APC with phosphatase did not eliminate Mnd2 binding. In vivo, the co-precipitation of each Mnd2 isoform with the APC was strikingly different and correlated well with the observed differences in sporulation and Clb5 levels for each strain. Taken together, these data do not support a role for mitotic Mnd2 phosphorylation in the direct regulation of APCAma1 ubiquitin ligase activity. Rather mitotic Mnd2 phosphorylation appears to be involved in a mitotic process that is independent of Ama1 but that has significant implications on the cell cycle once Ama1 is expressed at the beginning of meiosis, similar to the defects observed when Mnd2 was absent.
Despite its overall similarities to the deletion strain, some cells harboring mnd2-(S/T-A) are still capable of complete sporulation resulting in the formation of viable haploid spores. Thus, eliminating mitotic Mnd2 phosphorylation at the sites we discovered did not completely abolish the inhibitory function of Mnd2. Furthermore the high percentage of spore viability in the phosphomutant strains also suggests that mitotic phosphorylation of Mnd2 is only necessary before the first meiotic nuclear division because mutant cells that do form tetrads must be capable of completing normal meiotic nuclear divisions and spore formation. This observation is consistent with existing data that show that Mnd2 is necessary for the completion of recombination before the first meiotic nuclear division (30, 31). Conversely cells harboring mnd2-(S/T-D) were not capable of completely suppressing the sporulation defect of mnd2
Two different hypotheses could explain the difference in APC/Mnd2 association observed in our in vivo co-precipitation experiments compared with our in vitro APC binding assay. 1) Mitotic phosphorylation may be necessary to block the association of "seclusion factors" that could function to inhibit the association of Mnd2 with the APC in vivo. 2) Phosphorylation may be necessary to inhibit the degradation of Mnd2 during mitosis. Currently there is no evidence in support of the first hypothesis, although it has never been tested directly. With regard to the second hypothesis, others have found that phosphorylation can protect proteins from various forms of degradation including direct enzymatic proteolysis (49, 50) as well as ubiquitin-mediated proteolysis (51, 52). Consistent with this hypothesis, a decrease in the stability of Mnd2 would be expected to mimic an mnd2 The kinase(s) that phosphorylate Mnd2 remain unknown. Indeed the phosphorylation of Mnd2 during mitosis may not be caused by the same kinases responsible for its phosphorylation during meiosis. Currently the primary kinases known to phosphorylate the APC are cyclin-dependent kinase (Cdc28 in yeast) and polo-like kinase Cdc5. However, none of the Mnd2 phosphopeptides that we observed contained either a canonical cyclin-dependent kinase recognition sequence ((S/T)P) or the polo box domain recognition sequence (S(pS/pT)P where pT is phosphothreonine). Notably many of the phosphorylation sites implicated by our MS analysis fell within regions of high Asp/Glu residue content, which could suggest phosphorylation by casein kinase 2 (53). In addition to our discovery of Mnd2 phosphorylation, we also showed that Apc1 is phosphorylated during mitosis. Preliminary experiments showed that Apc1 is phosphorylated on a number of sites that are contained within a canonical cyclin-dependent kinase recognition sequence as well as some sites that are not.3 Further work will focus on characterizing these sites at different cell cycle stages and determining their role in APC-mediated mitotic and meiotic progression.
We showed that phosphorylation sites occupied differentially during the mitotic cell cycle can provide critical regulatory roles for the APC during meiosis. To our knowledge, this is the first case in which mitotic APC phosphorylation site mutants have been tested in meiosis. The fact that phosphorylation sites between the two types of nuclear division are shared in this way suggests that known mitotic phosphorylation sites within other APC subunits may also be required for meiosis. Future experiments that characterize the dynamics of APC phosphorylation during mitosis and meiosis will likely be invaluable to our understanding of APC regulation.
* This work was funded in part through a Ford Foundation Diversity Fellowship grant (to M. T.) and University of North Carolina startup funds (to C. B.). The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. 1 To whom correspondence should be addressed: University of Victoria Proteomics Centre, Vancouver Island Technology Park, #3101-4464 Markham St., Victoria, British Columbia V8Z 7X8, Canada. Tel.: 250-483-3221; Fax: 250-483-3238; E-mail: christoph{at}proteincentre.com.
2 The abbreviations used are: E3, ubiquitin-protein isopeptide ligase; APC, anaphase-promoting complex; HPLC, high pressure liquid chromatography; MALDI, matrix-assisted laser desorption ionization; TOF, time of flight; MS, mass spectrometry; GST, glutathione S-transferase; ACN, acetonitrile; BisTris, 2-[bis(2-hydroxyethyl)amino]-2-(hydroxymethyl)propane-1,3-diol; SPM, sporulation medium; DAPI, 4',6-diamidino-2-phenylindole; WT, wild type; YPD, yeast peptone dextrose; YP, yeast peptone.
3 M. P. Torres and C. H. Borchers, unpublished results.
We thank Henrik Dohlman, Mark Hall, Evgeniy Petrotchenko, and Jeanette Cook for helpful discussion and review of this manuscript. We also thank Randy Strich for yeast strains and Huy Duc Vu and Shelly Taylor for valuable technical support.
|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Advertisement | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||