|
Originally published In Press as doi:10.1074/jbc.M800589200 on March 11, 2008
J. Biol. Chem., Vol. 283, Issue 18, 11876-11886, May 2, 2008
Covalent Inactivation of Factor VIII Antibodies from Hemophilia A Patients by an Electrophilic FVIII Analog*
Stephanie Planque ,
Miguel A. Escobar ,
Keri C. Smith ,
Hiroaki Taguchi ,
Yasuhiro Nishiyama ,
Elizabeth Donnachie ,
Kathleen P. Pratt , and
Sudhir Paul 1
From the
Chemical Immunology Research Center, Departments of Pathology and Medicine and Gulf States Hemophilia and Thrombophilia Center, University of Texas-Houston Medical School, Houston, Texas 77030 and Puget Sound Blood Center and Division of Hematology, University of Washington, Seattle, Washington 98104-1256
Received for publication, January 23, 2008
, and in revised form, March 5, 2008.
 |
ABSTRACT
|
|---|
The antigen-binding sites of antibodies (Abs) can express enzyme-like nucleophiles that react covalently with electrophilic compounds. We examined the irreversible and specific inactivation of antibodies (Abs) to Factor VIII (FVIII) responsible for failure of FVIII replacement therapy in hemophilia A (HA) patients. Electrophilic analogs of FVIII (E-FVIII) and its C2 domain (E-C2) were prepared by placing the strongly electrophilic phosphonate groups at surface-exposed Lys side chains of diverse antigenic epitopes. IgG Abs to FVIII from HA patients formed stable immune complexes with E-FVIII and E-C2 that were refractory to dissociation by SDS treatment and boiling, procedures that dissociate noncovalent Ab-antigen complexes. The rate-limiting step in the reaction was formation of the initial noncovalent complexes. Conversion of the initial complexes to the irreversible state occurred rapidly. The antigenic epitopes of E-FVIII were largely intact, and most of the Abs were consumed covalently. E-FVIII expressed poor FVIII cofactor activity in clotting factor assays. Nonspecific interference by E-FVIII in clotting factor function was not evident. Treatment with E-FVIII, and to a lesser extent E-C2, irreversibly relieved the FVIII inhibitory effect of HA IgG in clotting factor assays. Small FVIII peptides did not display useful reactivity, highlighting the diverse epitope specificities of the Abs and the conformational character of FVIII epitopes. E-FVIII is a prototype reagent able to attain irreversible and specific inactivation of pathogenic Abs.
 |
INTRODUCTION
|
|---|
Specific antibodies (Abs)2 to individual antigens are thought to cause harmful effects in autoimmune diseases, transfusion of incompatible blood products, and organ transplantation. Inhibitory Abs to Factor VIII (FVIII) in hemophilia A (HA) are a well characterized example. HA is a chromosome X-linked genetic disorder characterized by the synthesis of functionally inactive FVIII. This impairs the intrinsic pathway of blood coagulation. The primary therapy for control of bleeding in HA patients is infusion of recombinant or plasma-derived FVIII (1). About 20–30% of patients receiving FVIII replacement therapy produce antibodies (Abs) to FVIII that inhibit FVIII cofactor activity. These are referred to clinically as "inhibitors." The inhibitory effect is thought to derive from reversible steric hindrance of FVIII interactions with phospholipids and other coagulation factors, including thrombin, Factor IXa (FIXa), and von Willebrand factor (2). In addition, some Abs inactivate FVIII permanently by catalyzing its proteolytic breakdown (3). Epitope mapping studies using FVIII fragments (heavy chain, light chains, and A2, A3, C1, and C2 domains) and FVIII hybrid molecules have suggested that many Abs are directed to conformational epitopes (4, 5). Most inhibitor positive patients mount a highly diverse immune response consisting of Abs to multiple FVIII epitopes located in the A2, C1, C2, and A3 domains (2, 6, 7).
The Abs pose major problems in managing acute bleeding episodes and surgical procedures in the patients. Short term bleeding in inhibitor-positive patients can be controlled by infusing activated prothrombin complex concentrates or recombinant factor VIIa, agents that bypass the requirement for FVIII in the coagulation pathway (8, 9). Refractory bleeds occur in about 20% of inhibitor-positive HA patients receiving bypass therapy, and an overdose carries the risk of inducing thrombotic events (9). In principle, FVIII itself could be infused to saturate the Abs and restore the coagulation pathway. However, massive quantities of FVIII are required to overcome the inhibitory effect of the circulating Abs even for a short duration. An important clinical advance has been the development of immune tolerance protocols in which high dose FVIII infusions are administered over prolonged periods to suppress Ab production by memory B lymphocytes (10, 11). Experimental peptides (5, 12) and anti-idiotypic Abs (13) have been reported to block FVIII inhibitory Abs by mimicking the structure of certain FVIII epitopes. Regrettably, there is no single immunodominant FVIII epitope, and these approaches do not adequately address the problem of diverse epitope reactivities of the Abs.
The combining sites of certain Abs contain enzyme-like activated nucleophiles. The Ab nucleophilic reactivities were evident from formation of covalent complexes with electrophilic phosphonate diesters (14–16), compounds that were originally developed as class-specific inhibitors of serine proteases (17). The phosphonates react with activated nucleophiles generated by intramolecular interactions between certain amino acids. For instance, the Ser side chain acquires enhanced nucleophilicity by virtue of the hydrogen-bonded network in the Ser-His-Asp catalytic triads of serine proteases (18). The nucleophilic sites permit certain Abs to catalyze the hydrolysis of their cognate antigens (19). Ser-His-Asp and Ser-Arg-Glu catalytic triads have been identified in proteolytic Abs by site-directed mutagenesis (20) and crystallography studies (21). Nucleophilic catalytic Abs that hydrolyze FVIII and inhibit FVIII cofactor activity are found in HA patients (3). However, only a subset of nucleophilic Abs displays catalytic activity (14), indicating that additional events in the catalytic cycle occurring after the initial nucleophilic attack on the peptide bond carbonyl group can be rate-limiting (e.g. water attack and product release).
We hypothesize that electrophilic FVIII (E-FVIII) analogs may relieve the anti-coagulant effect of Abs by reacting specifically and covalently with their nucleophilic sites. The covalent reaction is predicted to preclude dissociation of the immune complexes, thereby permitting prolonged Ab inactivation. We describe here E-FVIII analogs that relieve the FVIII inhibitory effect of Abs from patients with HA. E-FVIII is a prototypic therapeutic reagent for control of bleeding in inhibitor-positive HA patients. The observed properties of E-FVIII suggest that electrophilic antagonism can potentially be developed as a general basis for attaining specific inactivation of various antigen-specific pathogenic Abs found in immunological diseases.
 |
EXPERIMENTAL PROCEDURES
|
|---|
Electrophilic FVIII Analogs—Recombinant FVIII (Helixate, CSL Behring) in 10 mM HEPES, 150 mM NaCl, 0.025% Tween 20 was derivatized at Lys residues with the 3-sulfosuccinimidyl ester of diphenyl N-suberoyl-amino(4-amidinophenyl)methanephosphonate, and unincorporated phosphonate was removed by gel filtration (16). The phosphonate content of three E-FVIII preparations employed in this study was 52–76 mol of phosphonate/mol of FVIII determined by fluorescamine labeling of the residual amine groups (16). To prepare biotinylated E-proteins, biotin was first introduced into recombinant FVIII and C2 protein (22) by partial acylation in 10 mM HEPES, 150 mM NaCl, 0.1 mM CHAPS (14). This yielded FVIII and C2, respectively, containing 8.8 and 0.6 mol of biotin/mol of protein. Phosphonate labeling of biotinylated FVIII was as above (81 mol of phosphonate/mol of protein). Fast protein liquid chromatography-gel filtration of E-FVIII was on a Superose-6 column at a flow rate of 0.3 ml/min as described (23). Initial attempts to prepare E-C2 as described above for E-FVIII resulted in precipitation of the protein (>90%). Therefore, a phosphonate reagent with a more hydrophilic linker was prepared by treating diphenyl amino(4-amidinophenyl)methanephosphonate with di(N-succinimidyl) ethylene glycol disuccinate (Sigma), followed by reversed phase HPLC purification (observed m/z 722.5 (MH+) and calculated MH+ 722.2). Treatment of biotinylated C2 with this reagent yielded E-C2 preparations containing 6.7–8.2 mol of phosphonate/mol of C2. The E-VIP preparation has been described (15). The following peptides were prepared by Fmoc (N-(9-fluorenyl)methoxycarbonyl)-based solid phase synthesis: FVIII residues 484–508 with a Cys residue at the N terminus (N-acetyl-CRPLYSRRLPKGVKHLKDFPILPGEI); residues 1804–1819 (KNFVKPNETKTYFWKV); FVIII residues 2303–2332 with lysyl-biotin at the C terminus (TRYLRIHPQSWVHQIALKMEVLGCEAQDLYK-biotinamidohexanoyl); and the mimotope of a C2 epitope recognized by monoclonal Ab BO2C11 (SCHAWSNRRTCR) (12). The peptides were purified by HPLC (>95% purity) and characterized by matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) or electrospray ionization (ESI) mass spectroscopy (FVIII-(484–508), m/z (MALDI) 3076.0 (MH+; calculated MH+ 3075.7); FVIII-(2303–2332), m/z (ESI) 1356.2 ( , calculated 1356.4), 1018.0 ( , 1017.5), and 814.5 ( , 814.2); FVIII-(1804–1819), m/z (ESI) 677.4 ( , calculated 677.4), and 508.5 ( ; 508.3); BO2C11 epitope: m/z (MALDI) 1474.8 (MH+; calculated MH+ 1474.7)). E-(2303–2332) was prepared by regiospecific acylation (15) as follows. The resin with the 2303–2332 peptide protected at Lys-2320 side chain with the 4-methyltrityl group was treated with 1% trifluoroacetic acid in dichloromethane to remove this protecting group, and the Lys-2320 side chain amine was acylated with the N-hydroxysuccinimidyl ester of the phosphonate reagent used for E-FVIII preparation. Protecting groups and the solid support were removed with trifluoroacetic acid containing 2% phenol, 5% thioanisole, and 5% ethanedithiol, and E-(2303–2332) was purified by HPLC (m/z (ESI) 1529.5 ( , calculated 1529.5), 1147.3 ( , 1147.4), 917.6 ( , 918.1)]. The electrophilic analogs were stored at –80 °C as lyophilized powders. Protein concentrations were measured by the bicinchoninic acid assay.
Patients and Antibodies—This study was approved by the University of Texas Institutional Review Board. Plasma was prepared from blood in 3.2% sodium citrate from 8 inhibitor-positive HA patients (our lab codes: HA1828, HA1834, HA1835, HA2084, HA2085, HA2222, HA2223, and HA3112; age range 5–59 years). The patients had a history of FVIII inhibitors for at least 5 years but had not received FVIII replacement therapy for at least 2 months prior to the blood draw). The plasma FVIII titers were determined by Bethesda assay (24) and are reported in Table 1. Control plasma was from a nonhemophiliac human subject without known coagulation or autoimmune disorders (code NH1941). Electrophoretically homogeneous IgG from the plasma samples was purified by affinity chromatography using immobilized protein G (25). Fab fragments were prepared by digestion with immobilized papain and chromatography using immobilized protein A (26). Murine monoclonal anti-C2 IgG (clone ESH8) was from American Diagnostica. The isotype-matched control was monoclonal anti-VIP IgG (clone c23.5) (27).
View this table:
[in this window]
[in a new window]
|
TABLE 1 E-FVIII and E-C2 binding activity and FVIII inhibitor titer of antibodies from HA patients
NH is nonhemophiliac subject. FVIII inhibitor titers were measured in plasma samples and are reported in Bethesda assay units (BU). The E-FVIII and E-C2 binding activity at various dilutions of purified IgG (5–100 µg of IgG/ml) was determined in duplicate by ELISA, and the concentration yielding A490 values of 0.25 (IgG0.25) were computed from plots of A490 versus log10[Ab] fitted by linear regression.
|
|
Hapten Phosphonate Binding—Synthesis of hapten electrophilic probe E-hapten-1, E-hapten-2, and E-hapten-3 was described (14, 23, 28). FVIII (0.5 µM) was treated with the E-hapten probes (100 µM) for 4 h, and formation of irreversible adducts was measured by reducing SDS-electrophoresis as described (14).
E-FVIII and FVIII Binding—Abs were incubated with electrophilic or control polypeptides devoid of electrophilic groups in 10 mM HEPES, pH 7.5, 150 mM NaCl, 0.025% Tween 20 (HEPES/Tween) at 37 °C. The reaction mixtures were boiled (5 min) in 2% SDS and 3.3% 2-mercaptoethanol and subjected to SDS-electrophoresis. Adducts were detected and quantified in gel blots with peroxidase-conjugated streptavidin or goat anti-human IgG (Fc and / chain-specific, 1:1000; Sigma (16)). ELISAs were done using microtiter plates (Nunc) coated with 0.1 ml of FVIII, E-FVIII, C2, E-C2 (1 µg/ml), or synthetic FVIII peptides (4 µg/ml) in 100 mM NaHCO3, pH 9.5, and blocked with 5% skimmed milk in 10 mM sodium phosphate, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.05% Tween 20 (PBS/Tween). Ab binding was measured using peroxidase-conjugated goat anti-human IgG as above or goat anti-human Fab (Sigma) followed by peroxidase-conjugated rabbit anti-goat IgG (Pierce) (16). Binding to biotinylated E-(2303–2332) was measured similarly using streptavidin-coated plates (1 µg/ml). To measure irreversible binding, Abs were permitted to bind the immobilized antigens; the fluid was removed, and the wells were incubated for 30 min in PBS/Tween without (total binding) or with 2% SDS (SDS-refractory binding), followed by washing with PBS/Tween (16). Percent residual binding in SDS-treated wells was (A490, SDS-treated wells) x 100/(A490, PBS/Tween-treated wells). Samples displaying A490 > mean ± 3 S.D. for control IgG (from subject NH1941) were considered positive. Binding rate data were fitted to the equation A490/A490,max = 1 – exp(– Kt), where K is the pseudo-first order rate constant (K = (k3 x [Ab])/Kd); k3 is the first order rate constant for covalent bonding; Kd is the equilibrium dissociation constant for noncovalent binding step; [Ab] is the Ab concentration). t was computed as ln2/K. In the immunoadsorption experiment, HA IgG (0.7 µM) was incubated in diluent or biotinylated E-FVIII (0.1 µM) for 20 h, and the reaction mixture (0.04 ml) was incubated for 1 h with immobilized streptavidin in spin columns (30 µl of settled gel, UltraLink Plus columns, Pierce). The unbound fraction and three washes (0.05 ml each) were pooled and assayed for binding to FVIII and E-FVIII by ELISA.
Clotting Factor Assays—FVIII and E-FVIII cofactor activity was determined using the Diapharma Coamatic FVIII kit® as instructed by the manufacturer using 0.045-ml solutions of the proteins in HEPES/Tween. The method measures the ability of FVIIIa generated by thrombin cleavage to form the FIXa tenase complex responsible for FXa generation, which in turn hydrolyzes the chromogenic substrate N- -Z-D-Arg-Gly-Arg-p-nitroanilide. To measure FVIII inhibitor activity of Abs, IgG preparations from patients HA1828 (0.2 mg/ml), HA2222 (0.1 mg/ml), and HA3112 (0.1 mg/ml) were incubated with diluent or the electrophilic FVIII analogs in HEPES/Tween (0.1 ml; 20 h, 37 °C). Unbound electrophilic analogs in the reaction mixtures (0.1 ml) were removed by chromatography on protein G-Sepharose (0.04 ml of settled gel packed in Micro Biospin columns, Bio-Rad). The columns were washed with 5 ml of 50 mM Tris-HCl, pH 7.4, 0.1 mM CHAPS. Bound IgG was eluted with 0.1 M glycine, pH 2.7, 0.1 mM CHAPS (0.2 ml) in tubes containing 0.01 ml of 1 M Tris base, pH 9. The FVIII inhibitory activity of eluates was determined using the Coamatic assay or the one-stage activated partial thromboplastin time (APTT) clotting assay using APTT-SP reagent (29) (Instrumentation Laboratory) and an ACL300 plus coagulometer (Instrumentation Laboratory) according to the manufacturer's instructions. The standard curve was constructed from the clotting times of reference FVIII-containing plasma diluted in FVIII-depleted plasma (both from George King Bio-Medical, Inc.). Prior to the chromogenic FVIII inhibitor assay, FVIII (0.2 IU/ml, 0.025 ml) was incubated with the IgG eluates from protein G columns (0.025 ml; 1 h). Prior to the APTT clotting assay, pooled plasma from normal subjects (0.06 ml) was incubated with the IgG eluates (0.06 ml; 2 h). The concentrations of the FVIII inhibitory IgG in these assays yielded FVIII inhibition in the linear range of the inhibition curve (25–75% residual activity of reference FVIII-containing plasma).
 |
RESULTS
|
|---|
E-FVIII and E-C2—Multiple electrophilic phosphonate groups were placed on FVIII and C2 Lys residues (E-FVIII, 52 mol/mol; E-C2, 7 mol/mol; total available Lys residues, respectively, 158 and 9; Fig. 1A), producing diverse electrophilic epitopes. Reducing SDS-electrophoresis and silver staining of E-C2 indicated a single band with mass similar to underivatized C2 (18.6 kDa; Fig. 1B, lane 3). SDS gels of E-FVIII revealed major 225- and 86-kDa bands (respectively, intact FVIII and FVIII light chain), minor 96–200-kDa bands corresponding to known proteolytic FVIII fragments (3, 30), and smeared aggregate bands (nominal mass values 350 and 580 kDa close to the loading position; Fig. 1B, lane 1). Other than the aggregates, these bands were present in underivatized FVIII obtained from the supplier (Fig. 1B, lane 2). The aggregates constituted 21–32% of the total silver-stainable protein present in three preparations of E-FVIII examined.
We reported recently the presence of nucleophilic sites in various nonenzymatic proteins, evident from their covalent reaction with small molecule phosphonate diester compounds (E-haptens) containing a positive charge neighboring the electrophilic phosphorus atom (31). The presence of a naturally occurring nucleophilic site(s) in FVIII was suggested by the formation of a major 225-kDa adduct and a faint 86-kDa adduct of FVIII treated with a positively charged E-hapten-1 (Fig. 1C, lane 1). Only faint adduct bands were observed in reaction mixtures containing the poorly electrophilic control phosphonic acid (E-hapten-2) or the neutral phosphonate E-hapten-3. Control ovalbumin, a protein with minimal nucleophilic reactivity (31), did not form detectable E-hapten-1 adducts. The E-FVIII aggregates may therefore be interpreted to derive from intermolecular covalent bonding between the electrophilic phosphonate and a naturally occurring nucleophilic site(s) of FVIII.
To assess antigenic integrity, the binding of E-FVIII and E-C2 by Abs was determined by ELISA using affinity-purified IgG preparations from eight HA patients positive for FVIII inhibitory antibodies. All of the IgG preparations at 25 µg/ml displayed E-FVIII and E-C2 binding exceeding the mean ± 3 S.D. values for control IgG from the nonhemophilia subject (code NH1941; A490, respectively, 0.01 ± 0.01 and 0.07 ± 0.01). The IgG concentrations yielding an A490 value of 0.25 computed from dose-response curves are reported in Table 1. Fast protein liquid chromatography-gel filtration of E-FVIII permitted separation of an aggregate peak eluting close to the column void volume (retention time 18.3–21.6 min; 13% of protein loaded on the column) from unaggregated E-FVIII (retention time 43.3–46.0 min). The aggregates did not display reduced reactivity with IgG from an HA patient (HA1828) compared with unfractionated E-FVIII (A490 1.22 ± 0.02 and 0.85 ± 0.10, respectively; 30 µg/ml IgG, 93 ng/well E-FVIII aggregates or unfractionated FVIII), suggesting that the Ab-reactive epitopes aggregates are present in the aggregates. The ability of E-FVIII to consume anti-FVIII Abs was measured following solution phase reactions of HA1828 IgG with biotinylated E-FVIII. Immune complexes were removed using immobilized streptavidin, and free Abs in the unbound fraction were measured. This procedure resulted in essentially complete removal of Abs capable of binding FVIII or E-FVIII (Fig. 2). E-FVIII, therefore, is recognized by the majority of anti-FVIII Abs present in the HA IgG.

View larger version (34K):
[in this window]
[in a new window]
|
FIGURE 1. Electrophilic FVIII (E-FVIII) and C2 (E-C2 analogs). A, multidomain protein FVIII and the single domain protein C2 contain several phosphonate diester groups at Lys side chains to allow electrophile presentation within diverse antigenic epitopes. For detection of immune adducts, biotin was incorporated in the proteins as needed. E-hapten-1 is the biotin-containing small molecule phosphonate diester. E-hapten-2 is the poorly electrophilic phosphonic acid counterpart of E-hapten-1. E-hapten-3 is the counterpart devoid of the positively charged amidino function. B, silver-stained reducing SDS-polyacrylamide gels of E-FVIII (lane 1), FVIII (lane 2), E-C2 (lane 3), and C2 (lane 4) stained with silver. Marker protein migration is indicated on the left. C, streptavidin-peroxidase stained reducing SDS-polyacrylamide electrophoresis gels of FVIII (0.5 µM) treated with hapten probes (100 µM, 4 h). E-hapten-1, lane 1; E-hapten-2, lane 2; E-hapten-3, lane 3. Lane 4 shows the poorly nucleophilic protein ovalbumin treated identically with E-hapten-1.
|
|
Irreversible Immune Complexation—Formation of irreversible immune adduct of E-FVIII and Abs was initially studied by reducing SDS-electrophoresis and detection of large-mass bands by immunoblotting with anti-human IgG. The E-FVIII aggregates do not interfere in immune complex detection, as they are not stained by the anti-IgG reagent. Treatment of an anti-FVIII monoclonal Ab (directed to the C2 domain; clone ESH8) with E-FVIII but not FVIII devoid of the electrophilic groups resulted in formation of two large-mass bands stainable with anti-IgG Ab, one close to the sample loading position and the second with a nominal mass of 500 kDa (Fig. 3A). The theoretical mass of IgG adducts containing one and two 2 FVIII molecules are 415 and 680 kDa, respectively. The observed large-mass adducts were absent in E-FVIII treated with a control monoclonal Ab of the same isotype as the anti-FVIII Ab (IgG2a, ). IgG purified from all eight inhibitor-positive HA patients formed similar immune adducts with E-FVIII but not with FVIII (examples shown in Fig. 3B). Control IgG from the non-HA subjects did not form the adducts. The adducts were observed despite boiling and SDS denaturation, consistent with covalent E-FVIII binding by nucleophilic Ab sites. The electrophoresis studies do not reveal the precise molecular composition of the adducts, but they fulfill our purpose of unambiguously establishing the formation of irreversible and specific immune adducts. As in the case of E-FVIII, treatment of biotinylated E-C2 with the monoclonal anti-FVIII Ab resulted in formation of the predicted large-mass band stainable with streptavidin-peroxidase (nominal mass 187 kDa; anticipated mass of bivalent IgG complexed with 2 E-C2 molecules, 188 kDa; Fig. 3A). No 187-kDa complex was observed by treatment of E-C2 with an equivalent concentration of the control isotype-matched monoclonal Ab. IgG from all eight inhibitor-positive HA patients formed the 187-kDa complex with E-C2 but not C2 devoid of the electrophilic groups. Control IgG from the non-HA subjects did not form the complex or did so at very low levels (example in Fig. 3C). This rules out an indiscriminate covalent reaction of the phosphonate group as the explanation for formation of stable immune adducts by the HA IgGs.

View larger version (13K):
[in this window]
[in a new window]
|
FIGURE 2. Near-complete consumption of anti-FVIII Abs by E-FVIII. IgG HA1828 (0.7 µM) was incubated in solution phase with diluent or biotinylated E-FVIII (0.1 µM) for 20 h. Immune complexes and free E-FVIII were removed by affinity chromatography using streptavidin-agarose. The flow-through and wash fractions were pooled and assayed for binding to immobilized FVIII in A or E-FVIII in B by ELISA.
|
|

View larger version (16K):
[in this window]
[in a new window]
|
FIGURE 3. Irreversible binding of E-FVIII and E-C2 to anti-FVIII Abs. A, anti-mouse IgG-stained blots of an SDS-electrophoresis gel showing boiled reaction mixtures of E-FVIII (lane 1) or FVIII (lane 2) incubated with the anti-C2 domain monoclonal antibody (clone ESH8). Lane 3 shows E-FVIII incubated with an irrelevant isotype-matched antibody (IgG clone c23.5). Lanes 4–6 are, respectively, streptavidin-peroxidase-stained blots of an SDS gel showing boiled reaction mixtures of biotinylated E-C2 incubated with monoclonal Ab ESH8, biotinylated C2 incubated with monoclonal Ab ESH8, and biotinylated E-C2 incubated with the irrelevant isotype-matched Ab. Reaction conditions are as follows: IgG, 0.7 µM; E-FVIII, FVIII, biotinylated E-C2 or biotinylated C2, 0.2 µM (2 h, 37 °C). The anti-IgG-stained bands at 50 and 25 kDa in lanes 1 and 2 are the heavy and light chains, respectively. The bands at 80 and 70 kDa represent anomalously migrating Ab subunits. The streptavidin-stained band at 18.6 kDa in lanes 4–6 is the uncomplexed form of E-C2 and C2. B, representative anti-human IgG-stained blots of reducing SDS gels showing large-mass E-FVIII complexes with IgG from FVIII inhibitor-positive patients. Lanes 1 and 2, respectively, HA1828 IgG incubated with E-FVIII or FVIII. Lanes 3 and 4, respectively, HA2085 IgG incubated with E-FVIII or FVIII. Lane 5, E-FVIII incubated with NH1941 IgG (nonhemophilic IgG control). Reaction conditions are as in A. C, streptavidin-peroxidase-stained nonreducing SDS gels showing time-dependent formation of E-C2 immune complexes following incubation with FVIII inhibitor-positive IgG (mass 187 kDa). IgG was from HA subject HA1834 or control subject NH1941. Reaction conditions are as in A.
|
|
E-FVIII binding by Abs can be modeled as a two-step reaction, in which the initial step generates specific noncovalently associated immune complexes (state 1 in Fig. 4A) followed by conversion of these complexes to irreversible adducts (state 2) via covalent phosphonate bonding with Ab nucleophiles. The model is supported by the following observations. Inclusion of excess FVIII devoid of the phosphonates in the reaction mixture at t = 0 inhibited E-FVIII binding by the HA IgG preparations, indicating specificity typical of conventional Ab-antigen noncovalent binding reactions (Fig. 4B). We measured the dissociation of E-FVIII immune complexes formed by the polyclonal HA IgG by removing the free IgG and incubating the reaction mixture for 20 h in excess FVIII (which precludes reassociation of dissociated complexes). Seventy five percent of the immune complexes remained in the associated state (Fig. 4C). Under these conditions, there was near-complete dissociation of the noncovalent immune complexes formed by the high affinity monoclonal anti-FVIII Ab (clone ESH8, Kd 0.4 nM; Ref. 32) with FVIII devoid of the phosphonates. This is consistent with the observed dissociation rates of other high affinity noncovalent immune complexes (33). As the experimental protocol effectively distinguishes between noncovalent and irreversible complexes, it may be concluded that the majority of the complexes is converted to the irreversible state.

View larger version (18K):
[in this window]
[in a new window]
|
FIGURE 4. Specific irreversible E-FVIII binding by HA IgG preparations. A, two-step reaction model for generation of irreversible adducts E-FVIII and Abs. The initial noncovalent binding reaction imparts specificity to the reaction (state 1). The covalent reaction occurs if the electrophilic phosphonate is in register with a naturally occurring nucleophile in the Ab combining site (state 2). B, saturability of E-FVIII binding by HA1828 IgG (0.07 µM) evident from competitive inhibition with excess FVIII (0.25 µM) included in the reaction mixture. Total binding was determined in PBS. Incubation time was 4 h. C, nondissociable E-FVIII complexation by HA1828 IgG. Top, assay protocol. Left, after formation of immobilized E-FVIII immune complexes with HA1828 IgG for 4 h as in A, free IgG was removed by extensive washing, and the complexes were allowed to dissociate over 20 h in the presence of excess FVIII (0.25 µM). Binding in PBS prior to IgG removal is labeled Binding, t = 0. Binding after removal of IgG and incubation for 20 h in excess FVIII is labeled Nondissociable binding, t = 20. Right, same experimental protocol was applied to determine nondissociable binding of FVIII devoid of the electrophilic groups with the monoclonal anti-FVIII IgG ESH8 (0.07µM). Values are corrected for nonsaturable binding in wells that received excess FVIII at t = 0 the reaction (nonsaturable A490 for HA IgG, 0.21; for ESH8 IgG, 0.14).
|
|
Irreversible immune complexation was studied further by an ELISA method entailing dissociation of the noncovalent state 1 complexes with 2% SDS (30 min of treatment). The protocol has been validated in our previous report of covalent complexation of human immunodeficiency virus gp120 by Abs (16). Treatment with SDS dissociated the noncovalent complexes of FVIII devoid of the electrophilic phosphonates and the high affinity anti-FVIII monoclonal Ab (<10% residual binding after SDS treatment). After incubation with IgG preparations from HA patients (n = 8) for 2 h, 77.6 ± 9.1% complexes formed by E-FVIII and 66.3 ± 17.6% of the complexes formed by E-C2 (mean ± S.D.) were refractory to dissociation by SDS (Fig. 5A). The proportion of SDS-refractory complexes reached plateau levels within 30 min (Fig. 5B), indicating rapid conversion of the state 1 noncovalent complexes to state 2 irreversible adducts. t values for formation of the complexes in nondenaturing solvent (PBS; state 1 + state 2 complexes) and SDS (state 2 complexes) were comparable (2.5 and 2.3 h, respectively). This suggests that noncovalent binding of E-FVIII and Abs is the rate-limiting step in accumulation of the covalent adducts. Taken together, it may be concluded that the electrophilic phosphonates are in sufficient proximity with Ab nucleophiles in a majority of noncovalent complexes to allow conversion to the covalently associated state. Approximately 15% of the E-FVIII immune complexes remained SDS-dissociable in Fig. 5B, suggesting that the covalent bonding is disallowed in a minority of complexes. Fab fragments prepared from the IgG of patient HA1828 displayed SDS-refractory binding to E-FVIII equivalent to intact IgG (Fig. 5C). This suggests that an avidity effect because of bivalent IgG binding is not a factor, and the irreversible binding can be attributed to monovalent Ab combining sites.
Irreversible Loss of Antibody Inhibitory Activity—The functional effect of E-FVIII and E-C2 was studied by measuring irreversible loss of FVIII inhibitory activity of IgG from patients HA1828, HA2222, and HA3112 (plasma FVIII inhibitor titer: 800, 1011, and 198 Bethesda assay units/ml, respectively). The IgGs were treated with E-FVIII (0.1 µM), E-C2 (1 µM), or control E-VIP (0.1 and 1 µM). Protein G-Sepharose columns were used to capture free IgG and immune complexes, and free polypeptides were removed by extensive washing. Column eluates from reaction mixtures of IgG and the E polypeptides were tested for the ability to inhibit FVIII cofactor activity by the chromogenic Factor Xa (FXa) generation assay or the one-stage APTT assay. The FXa generation assay measures the ability of FVIII to generate the catalytic complex with FIXa responsible for converting FX to FXa. The APTT assay measures the time to clot formation of plasma after initiating the coagulation cascade by phospholipid contact activators that promote Factor XII conversion to Factor XIIa. Several control experiments were conducted prior to studying E-FVIII and E-C2 effects. Dose-dependent inhibition of FVIII cofactor activity was observed in both assays using protein G eluates from control reactions containing increasing HA IgG concentrations (16–100 µg/ml) and diluent. The recovery of FVIII inhibitory activity in the eluates was 67–95% of the activity predicted from the plasma Bethesda titers of the three HA patients. Identically processed IgG from a non-HA subject treated with diluent was devoid of FVIII inhibitor activity. Eluates obtained by chromatography of 0.1 µM FVIII in diluent without IgG did not display detectable FVIII activity, confirming removal of free polypeptides by the chromatography procedure. Similarly processed E-FVIII or E-C2 in diluent without IgG did not express detectable FVIII activity.
Treatment of the IgG preparations with the irrelevant E-polypeptide E-VIP was without noticeable effect on the FVIII inhibitor activity (<15% loss of activity compared with diluent-treated inhibitory IgGs). In comparison, treatment with 0.1 µM E-FVIII relieved the FVIII inhibitor activity of the three IgG preparations by an average of 87.9 ± 7.1% (S.D.) and 69.2 ± 5.2%, respectively, determined by the chromogenic FXa and APTT assays (Fig. 6A). E-C2 was less potent than E-FVIII, and higher concentrations of E-C2 were necessary to obtain IgG inactivation. Treatment with 1.0 µM E-C2 relieved the FVIII inhibitor activity of the IgG preparations by 40.1 ± 17.8 and 29.6 ± 13.5%, respectively, determined by the FXa and APTT assays (Fig. 6B). From these results, it may be concluded that irreversible occupancy of the Ab combining sites by E-FVIII and E-C2 results in loss of the IgG FVIII inhibitory activity.

View larger version (13K):
[in this window]
[in a new window]
|
FIGURE 5. Irreversibility of E-FVIII complexation with Abs in denaturing solvent. A, SDS-refractory binding of E-FVIII and E-C2 by HA IgG. Plotted are values of residual binding that survived treatment with 2% SDS for 30 min, expressed as percent of total binding without SDS treatment. A490 values for total E-FVIII and E-C2 binding by IgGs from individual patients were as follows, respectively: HA1828, 1.20 and 1.24; HA1834, 1.20 and 0.68; HA1835, 1.09 and 0.96; HA2084, 0.97 and 1.02; HA2085, 1.30 and 0.84; HA2222, 1.12 and 0.73; HA2223, 0.83 and 0.45; and HA3112, 0.79 and 0.36. IgG concentrations, 6.3–100.0 µg/ml (adjusted to yield reliable A490 values from preliminary dose-response experiments). Residual binding was calculated as: 100 x (A490,PBS – A490,SDS)/A490,PBS. B, time course of total and SDS-refractory E-FVIII binding by HA1828. Residual binding was computed as in A. IgG HA1828 was 25 µg/ml. C, irreversible E-FVIII binding by Fab fragments from IgG HA1828. Total binding and SDS-refractory binding by Fab fragments (75 µg/ml) were determined as in A. Inset, Coomassie Blue-stained SDS-electrophoresis gels (nonreducing) of IgG (lane 2) and Fab (lane 3). Molecular mass markers, lane 1.
|
|
E-FVIII Reactivity with Coagulation Factors—The cofactor role of FVIII in blood coagulation depends on interactions of discrete FVIII regions with various coagulation proteins and phospholipids (34). We compared the ability of E-FVIII and FVIII to generate FXa. E-FVIII or FVIII was incubated with a mixture of FIXa, thrombin, calcium chloride, phospholipids, and FX. FXa enzymatic activity was quantified using a chromogenic peptidyl ester substrate. FXa activities in the presence of E-FVIII were 2–3 orders of magnitude lower than in the presence of FVIII (EC50 values, respectively, 14.8 and 0.03 IU/ml; Fig. 7A). Thrombin, FIXa, and FXa are serine proteases. We examined the possibility that nonspecific serine protease inhibition by the electrophilic phosphonates is the reason for low FXa activity observed in the presence of E-FVIII. Comparable activities of FXa generation were evident in the presence of FVIII alone or FVIII mixed with E-FVIII, indicating the presence of fully functional serine proteases (Fig. 7B). As an additional test of nonspecific serine protease inhibition, FVIII-containing normal human plasma was incubated for 2 h at 37 °C with an equal volume of diluent or E-FVIII (100 nM; corresponding 110 IU FVIII/ml; physiological concentration of FVIII 1 IU/ml). E-FVIII did not prolong the time to clot formation determined by the APTT test compared with control assays conducted in the absence of E-FVIII (59.0 ± 0.1 s). This suggests that E-FVIII does not interfere with serine protease factors involved in blood coagulation.
FVIII Peptide Analogs—At high concentrations, the 2315–2332 region of the C2 domain is suggested to relieve partially the FVIII inhibitory effect of Abs found in some but not all inhibitor-positive HA patients (35). We prepared the electrophilic analog of the synthetic FVIII peptide 2303–2332 containing the phosphonate at Lys-2320 (E-(2303–2332), Fig. 8A). No E-(2303–2332) binding by IgG from our inhibitor-positive HA patients was detected by ELISA (n = 7 patients; A490 < 0.1; data not shown). Denaturing electrophoresis of boiled reaction mixtures containing excess biotinylated E-(2303–2332) revealed small amounts of immune adducts formed by IgG from two of the seven HA patients but not control IgG from the non-HA subject (56-kDa IgG heavy chain band, Fig. 8B). However, treatment of these IgG preparations without and with excess E-(2303–2332) (20 µM) did not influence their FVIII inhibitory activity (Fig. 8C). This suggests that E-(2303–2332) binding Abs do not constitute a functionally significant proportion of the FVIII inhibitory Abs in these subjects. Certain other FVIII synthetic peptides are recognized by anti-FVIII Abs found in HA patients with low affinity. In this study, we tested the following peptides (devoid of phosphonate groups): A2 domain residues 484–508 (36), A3 domain residues 1804–1819 (37), and BO2C11 peptide, a mimetic of a C2 domain conformational epitope (12). The peptides were not bound detectably by the seven HA IgG preparations studied (A490 < 0.1). At a concentration of 200 µM, the peptides failed to relieve the FVIII inhibitor activity of the HA IgG preparations (measured as in Fig. 8C; <15% difference for diluent-treated IgG; data not shown). We concluded that the reactivity of the peptides with the Abs is insufficient to afford useful Ab inactivation. Previous reports have also suggested that the inhibitory Abs recognize large FVIII polypeptide fragments (6) better than small peptides, suggesting that the Abs are directed mainly to conformational rather than linear epitopes (12, 35, 36).
 |
DISCUSSION
|
|---|
Infused FVIII is ineffective in correcting defective blood coagulation in a subpopulation of FVIII-deficient HA patients producing inhibitory Abs to the protein. Here we describe electrophilic FVIII analogs that bind specifically and covalently to the nucleophilic sites of Abs. E-FVIII and E-C2 were bound irreversibly by IgG preparations from each of eight inhibitor-positive HA patients studied. The unique mechanism of action of the electrophilic analogs was also evident from irreversible relief of FVIII inhibition by the Abs in coagulation assays. Full-length E-FVIII inactivated the Abs with superior potency compared with E-C2 and synthetic FVIII peptides. This is consistent with findings that HA patients produce Abs directed to diverse FVIII epitopes outside the C2 domain (2, 35). Our studies provide proof-of-principle that targeting of Ab nucleophilic sites can relieve the pathogenic effects of Abs. The strengths of this approach and potential means to address its weaknesses are discussed below.
Irreversible reactions of E-FVIII and E-C2 with Abs from HA patients were evident from the failure of denaturing treatments to dissociate the immune adducts. Similarly, a majority of the adducts remained undissociated in nondenaturing solvent after removal of free Abs and prolonged incubation in excess competitor FVIII. There was no evidence that E-FVIII or E-C2 react nonspecifically with irrelevant Abs. This supports a two-step reaction model in which initial noncovalent binding confers specificity to the reaction, followed by covalent bonding of the electrophilic phosphonates with Ab nucleophiles. Conversion of the noncovalent complexes to irreversible adducts was rapid, and noncovalent E-FVIII binding by the Abs was rate-limiting. This is consistent with the strong electrophilicity of phosphonate diesters evident from the study of nucleophilic enzymes. The first order rate constant for the reaction of a phosphonate diester with trypsin is 0.03 s–1 (15, 38). IgG nucleophilic reactivities can exceed that of trypsin (14), consistent with rapid conversion of noncovalent E-FVIII immune complexes to irreversible adducts. We did not address in detail the extent of damage to the antigenic structure of FVIII caused by introducing phosphonate groups. However, all eight HA IgG preparations displayed E-FVIII binding. The observed E-FVIII aggregation reaction is likely because of the reactivity of phosphonate groups with an endogenous nucleophile of FVIII. Formation of the aggregates did not appear to impact the reaction with Abs negatively, as the aggregates were bound by an HA IgG preparation comparably to unfractionated E-FVIII. Treatment with excess E-FVIII resulted in near-complete consumption of FVIII binding Abs, indicating that most epitopes recognized by the Abs are expressed on E-FVIII.

View larger version (14K):
[in this window]
[in a new window]
|
FIGURE 6. Loss of FVIII inhibitory activity of antibodies by treatment with E-FVIII (A) and E-C2 (B) determined by the APTT clotting assay and chromogenic FXa assay. IgG from three inhibitor-positive patients (HA1828, 200 µg/ml; HA2222, 100 µg/ml; HA3112, 100 µg/ml) was treated with E-FVIII or E-VIP (0.1 µM; A) and E-C2 or E-VIP (1.0 µM; B) in 0.1-ml reaction mixtures for 20 h. Free E-polypeptides were removed by protein G affinity purification. IgGs along with any stable immune complexes were recovered with 0.2 ml of elution buffer. FVIII cofactor activity was determined by the one-stage APTT clotting assay with 0.06-ml eluates mixed with an equal volume of FVIII-containing normal plasma (incubation for 2 h, 37 °C). FVIII cofactor activity was determined by the chromogenic FXa assay (Diapharma Coamatic kit) as in Fig. 4 with 0.025-ml column eluates incubated with recombinant FVIII (0.025 ml; 0.2 IU/ml; 1 h, 37 °C). Percent relief from FVIII inhibitory activity was computed as follows: (FVIII inhibitor activity in the presence of E-VIP – FVIII inhibitor activity in the presence of E-FVIII or E-C2) x 100/(FVIII inhibitor activity in the presence of E-VIP), where FVIII inhibitor activity denotes (FVIII cofactor activity in the absence of IgG – FVIII cofactor activity in the presence of IgG). FVIII inhibitor activity was read from the linear portion of the curve constructed using various dilutions of standard FVIII-containing plasma (0.95 IU/ml). Values plotted are means of duplicates ± S.D. A, FVIII activity levels without IgG treatment in the APTT and chromogenic FXa assays were, respectively, 0.37 ± 0.01 and 0.045 ± 0.015 IU/ml. In the APTT assay, FVIII activities in the presence of IgG from subjects HA1828 (100 µg/ml), HA2222 (50 µg/ml), and HA3112 (50 µg/ml) treated with control E-VIP were, respectively, 0.11 ± 0.06, 0.04 ± 0.01, and 0.07 ± 0.01 IU/ml. The FVIII activities in presence of these IgG preparations (4.5 µg/ml) treated with control E-VIP in the chromogenic FXa assay were 0.019 ± 0.007, 0.030 ± 0.003, and 0.000 ± 0.001 IU/ml. B, FVIII activity in the absence of IgG in the APTT and chromogenic FXa assays were, respectively, 0.36 ± 0.02 and 0.054 ± 0.009 IU/ml. In the APTT assay of B, FVIII activities in the presence of IgG from subjects HA1828 (33 µg/ml), HA2222 (16 µg/ml) or HA3112 (16 µg/ml) treated with control E-VIP were, respectively, 0.25 ± 0.03, 0.18 ± 0.01 and 0.21 ± 0.8 IU/ml. The FVIII activities in the presence of IgG from subjects HA1828 or HA2222 (4.5 µg/ml) treated with control E-VIP in the chromogenic FXa assay were 0.013 ± 0.005 and 0.018 ± 0.001 IU/ml.
|
|

View larger version (9K):
[in this window]
[in a new window]
|
FIGURE 7. Clotting factor activity of E-FVIII. A, recombinant FVIII and E-FVIII were assayed for formation of the FVIIIa-FIXa tenase complex responsible for FXa activation. Shown are A405 values (means of duplicates ± S.D.) corresponding to FXa-catalyzed hydrolysis of N- -benzyloxycarbonyl-D-Arg-Gly-Arg-p-nitroanilide. B, inability of E-FVIII to interfere with clotting factor activity of FVIII. Activation of FXa by FVIII alone, E-FVIII alone, or FVIII mixed with an equivalent mass of E-FVIII was measured as in A.
|
|
To determine the functional consequence of irreversible occupancy of Ab combining sites, free E-FVIII was removed from the E-FVIII/IgG reaction mixtures prior to clotting factor assays. E-FVIII-treated HA IgG preparations displayed reduced FVIII inhibitor activity (by 61–99%). An irrelevant E-polypeptide was without effect, suggesting specific Ab inactivation. The functional results are consistent with biochemical studies indicating that the majority of noncovalent complexes are converted to irreversible adducts. It may be concluded that electrophilic phosphonates are available for covalent bonding in most FVIII epitopes recognized by Abs. This is significant, as diverse Abs directed to various FVIII epitopes must be inactivated irreversibly to obtain a functionally useful effect. The linker attaching the phosphonate groups to FVIII contains single bonds around which rotation is permissible. The resultant spatial freedom enjoyed by the phosphonates should facilitate approach of the electrophilic phosphorus atom within covalent binding distance of Ab nucleophiles. Conversely, the failure of a minority of the reversibly associated complexes to convert to the irreversible state suggests room for improvement in the structure of the E-FVIII. Factors that may limit the covalent reaction are as follows: (a) some epitopes may not be labeled with the electrophilic phosphonate if they do not contain a sufficiently exposed Lys residue; (b) the distance between the phosphonate and Ab nucleophile or the spatial orientation of these groups may be nonpermissive for covalent bonding; and (c) a minority of the Abs may lack nucleophilic sites. We hold the last mentioned possibility unlikely as the nucleophilic reactivity was expressed by the variable domains of every recombinant Ab fragment and monoclonal Ab examined previously (14, 23). That the irreversible E-FVIII binding activity in this study is a property of Ab variable domains is confirmed by observations that the antigen binding Fab fragments of IgG displayed this activity.

View larger version (18K):
[in this window]
[in a new window]
|
FIGURE 8. Covalent binding of peptide E-(2303–2332) to inhibitory IgG and effect on FVIII inhibitor activity. A, structure of the E-(2303–2332) peptide analog. P and Bt denote, respectively, the phosphonate and biotin groups. B, streptavidin-peroxidase-stained blot of a reducing SDS-electrophoresis gel showing boiled reaction mixtures of biotinylated E-(2303–2332) (10 µM) incubated with HA1834 IgG, HA1835 IgG or control NH1941 IgG (75 µg/ml; 20 h, 37 °C). The bands at the bottom of the lanes and the 56-kDa position represent, respectively, the free E-(2303–2332) and E-(2303–2332) complexed to the heavy chains of the IgG. C, FVIII inhibitory activity of IgG preparations treated with E-(2303–2332). FVIII cofactor activity was measured by the APTT assay after incubation of HA IgG1834 or HA IgG 1835 (400µg/ml) with E-(2303–2332) (20 µM; 20 h at 37 °C) and treatment of FVIII-containing normal plasma with varying concentrations of the reaction mixtures (diluted 1/2 and 1/6). FVIII inhibitory activity was computed as follows: 100 –100 x (FVIII activity in presence of IgG/FVIII activity in absence of IgG). FVIII activity in absence of IgG was 0.54 IU/ml. Experimental procedures were as in Fig. 6. Values plotted are means of duplicates ± S.D.
|
|
FX activation occurs via formation of the FVIIIa-FIXa complex on phospholipid surfaces ("tenase complex"). E-FVIII was a poor activator of FX compared with underivatized FVIII. A low level risk of thrombotic events is associated with overdose of bypass reagents such as recombinant Factor VII (9). The poor cofactor activity of E-FVIII may be a functionally useful property, as this diminishes the risk of a thrombotic effect. Possible reasons for the poor cofactor activity of E-FVIII are as follows: (a) structural perturbations because of introduction of phosphonate groups may render E-FVIII resistant to thrombin hydrolysis; (b) even if E-FVIIIa is produced by thrombin hydrolysis, it may not form the tenase complex; or (c) E-FVIII may inhibit serine proteases indiscriminately. Possibilities a and b are innocuous, in that they should not produce undesirable effects. The potential inhibition of serine proteases involved in the coagulation pathway, however, merits attention. High micromolar to millimolar concentrations of small molecule phosphonates are reported to bind covalently to the nucleophilic sites of serine proteases (17). E-FVIII did not interfere with FVIII-dependent hydrolysis of the peptidyl ester substrate catalyzed by FXa, indicating that it does not inhibit the enzymes necessary for this reaction (thrombin, FIXa, and FXa). Moreover, no prolongation of the time to fibrin clot formation was observed in the APTT test at an E-FVIII concentration that relieved the FVIII inhibitor activity of the Abs irreversibly. These observations indicate that E-FVIII can selectively inactivate Abs without functionally significant inhibition of serine protease clotting factors.
The phosphonate-containing E-FVIII is a first generation reagent. Future genetic and chemical manipulations may help develop improved E-FVIII analogs. As the selectivity of the reaction derives from noncovalent Ab binding, the conformation of E-FVIII should preferably be as close to native FVIII as feasible. As the covalent reactivity of E-FVIII is not rate-limiting, it may be useful to reduce the electrophilicity of E-FVIII to further minimize reactions with non-Ab serine proteases while maintaining sufficiently rapid covalent Ab bonding capability. Carbon-based electrophiles placed at defined positions within FVIII may offer sufficient electrophilicity to inactivate Abs directed to individual epitopes with minimal overall structural perturbation of FVIII. Electrophilic pyruvate analogs and dicarbonyl compounds react covalently with protein nucleophilic sites (38, 39), and suppressor tRNA technologies for incorporation of such compounds into the protein backbone are available (40). The half-life of FVIII in human circulation (t ) is 12 h (41). Aggregation of proteins can influence their clearance in vivo. E-FVIII aggregation appears to involve a naturally occurring nucleophile that reacts with the phosphonate groups. Availability of an FVIII mutant with deficient nucleophilicity will help minimize the aggregation reaction. Site-directed mutagenesis has been applied previously to generate enzymes and Abs with deficient nucleophilic reactivity (20, 42). A significant proportion of inhibitory Abs to FVIII in HA patients is directed to the C2 domain (43). However, Ab diversity and the conformational character of the immunodominant epitopes pose significant challenges. This is illustrated by our observations using E-C2 and E-(2303–2332), a C2 peptide analog. E-C2 was consistently less reactive with HA IgG than E-FVIII. E-(2303–2332) displayed very limited reactivity. For these reasons, developing mixtures of large E-FVIII polypeptides or optimization of the full-length E-FVIII structure are preferred routes to clinical application of the covalent inactivation approach described here.
The FVIII inhibitory potencies of Abs in HA patients can vary over 3 log orders, and the titers can exceed 1000 Bethesda assay units/ml (44, 45). The magnitude of the titers depends on the concentration and affinity of Abs directed to the neutralizing FVIII epitopes. The irreversible reaction of E-FVIII offers the advantage of more potent Ab inactivation if certain conditions are met. For example, 84% of 1 nM Ab with Kd 10 nM will be in free state after equilibrium is attained with 2 nM reversibly binding antigen (see supplemental Fig. S1). Assuming a covalent binding rate constant that does not limit the overall reaction rate (as observed in this study), only 6% of the Ab will exist in free state after incubation for 12 h with an irreversible binding antigen. Consumption of the Abs by the irreversible antigen will occur at superior levels as long as the Ab concentration does not exceed the Kd. With increasing Ab concentration or decreasing Kd values, Ab consumption by the irreversible and reversible antigen will approach equivalence, and the potential advantage of the former antigen is lost. Even if the Abs are initially consumed at equivalent levels by E-FVIII and FVIII, the former reagent should provide more long lasting Ab inactivation in vivo. With reducing concentrations of free FVIII in blood because of metabolic clearance, a progressive reduction in the concentration of reversibly associated immune complexes will occur. The irreversibly associated E-FVIII immune complexes, on the other hand, are not subject to dissociation because of metabolic clearance of E-FVIII. With respect to catalytic Abs, a nonhydrolyzable antigen analog such as E-FVIII offers superior inactivation potency even when [Ab] > Kd (see supplemental Fig. S1).
In addition to Abs to FVIII, other antigen-specific Abs exert harmful effects in various diseases, e.g. autoantibodies to the acetylcholine receptor in myasthenia gravis (46) and to platelet antigens in autoimmune thrombocytic purpura (47). Nonspecific immunosuppressive agents are used to control Ab production, but this is often accompanied by profound side effects and enhanced susceptibility to infection. As several electrophilic polypeptides are documented to bind their cognate Abs irreversibly (14, 15), it is reasonable to consider the generality of the irreversible Ab targeting approach in future studies. Consideration of the effect of electrophilic antigens on the cells responsible for Ab synthesis is also warranted. Antigen binding to the antigen receptor (immunoglobulins complexed to signal transducing proteins) drives maturation of B lymphocytes into Absecreting cells. Saturation of the antigen receptor induces B cell apoptosis and immune tolerance (48, 49). Administration of very large amounts of FVIII on the order of grams induces immune tolerance to FVIII in a subpopulation of HA patients (10, 11). We reported covalent binding of an electrophilic hapten to nucleophilic B cell antigen receptors (23). Electrophilic antigen analogs are predicted to saturate cellular antigen receptors more readily than the reversibly binding antigen. In preliminary studies (50) we observed that prior treatment with E-FVIII attenuated Ab synthesis by B cells challenged with FVIII. Taken together, these considerations support further development of electrophilic antigen analogs for irreversible inactivation of pathogenic Abs.
 |
FOOTNOTES
|
|---|
* This work was supported by grants from the Hemophilia Associations of New York and Georgia and National Institutes of Health Grant AI31268. The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact. 
The on-line version of this article (available at http://www.jbc.org) contains supplemental Fig. S1. 
1 To whom correspondence should be addressed: Dept. of Pathology, University of Texas, Houston Medical School, 6431 Fannin, Houston, TX 77030. E-mail: Sudhir.Paul{at}uth.tmc.edu.
2 The abbreviations used are: Ab, antibody; APTT, activated partial thromboplastin time; E-C2, C2-domain analog containing electrophilic phosphonates; E-hapten, electrophilic hapten; E-FVIII, electrophilic Factor VIII; FVIII, Factor VIII; FIXa, activated Factor IX; FX, Factor X; FXa, activated Factor X; HA, hemophilia A; VIP, vasoactive intestinal peptide; ELISA, enzyme-linked immunosorbent assay; CHAPS, 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic acid; HPLC, high pressure liquid chromatography; MALDI-TOF, matrix-assisted laser desorption ionization time-of-flight; Z, benzyloxycarbonyl; PBS, phosphate-buffered saline; ESI, electrospray ionization. 
 |
ACKNOWLEDGMENTS
|
|---|
We thank Y. Bangale, R. Dannenbring, and T. Yoshikawa for assistance and CSL Behring for recombinant FVIII.
 |
REFERENCES
|
|---|
- Ettingshausen, C. E., and Kreuz, W. (2006) Haemophilia 12, Suppl. 6, 102–106
- Scandella, D. (1999) Vox Sang. 77, Suppl. 1, 17–20[Medline]
[Order article via Infotrieve]
- Lacroix-Desmazes, S., Moreau, A., Sooryanarayana, Bonnemain, C., Stieltjes, N., Pashov, A., Sultan, Y., Hoebeke, J., Kazatchkine, M. D., and Kaveri, S. V. (1999) Nat. Med. 5, 1044–1047[CrossRef][Medline]
[Order article via Infotrieve]
- Spiegel, P. C., Jr., Jacquemin, M., Saint-Remy, J. M., Stoddard, B. L., and Pratt, K. P. (2001) Blood 98, 13–19[Abstract/Free Full Text]
- Villard, S., Piquer, D., Raut, S., Leonetti, J. P., Saint-Remy, J. M., and Granier, C. (2002) J. Biol. Chem. 277, 27232–27239[Abstract/Free Full Text]
- Lavigne-Lissalde, G., Schved, J. F., Granier, C., and Villard, S. (2005) Thromb. Haemostasis 94, 760–769[Medline]
[Order article via Infotrieve]
- Kopecky, E. M., Greinstetter, S., Pabinger, I., Buchacher, A., Romisch, J., and Jungbauer, A. (2006) J. Immunol. Methods 308, 90–100[CrossRef][Medline]
[Order article via Infotrieve]
- Lloyd Jones, M., Wight, J., Paisley, S., and Knight, C. (2003) Haemophilia 9, 464–520[CrossRef][Medline]
[Order article via Infotrieve]
- Berntorp, E., Gringeri, A., Leissinger, C., Negrier, C., and Key, N. (2006) Semin. Thromb. Hemostasis 32, Suppl. 2, 22–27[CrossRef][Medline]
[Order article via Infotrieve]
- Brackmann, H. H. (1984) Prog. Clin. Biol. Res. 150, 181–195[Medline]
[Order article via Infotrieve]
- Brackmann, H. H., and Gormsen, J. (1977) Lancet 2, 933[Medline]
[Order article via Infotrieve]
- Villard, S., Lacroix-Desmazes, S., Kieber-Emmons, T., Piquer, D., Grailly, S., Benhida, A., Kaveri, S. V., Saint-Remy, J. M., and Granier, C. (2003) Blood 102, 949–952[Abstract/Free Full Text]
- Gilles, J. G., Grailly, S. C., De Maeyer, M., Jacquemin, M. G., VanderElst, L. P., and Saint-Remy, J. M. (2004) Blood 103, 2617–2623[Abstract/Free Full Text]
- Planque, S., Taguchi, H., Burr, G., Bhatia, G., Karle, S., Zhou, Y. X., Nishiyama, Y., and Paul, S. (2003) J. Biol. Chem. 278, 20436–20443[Abstract/Free Full Text]
- Nishiyama, Y., Bhatia, G., Bangale, Y., Planque, S., Mitsuda, Y., Taguchi, H., Karle, S., and Paul, S. (2004) J. Biol. Chem. 279, 7877–7883[Abstract/Free Full Text]
- Paul, S., Planque, S., Zhou, Y. X., Taguchi, H., Bhatia, G., Karle, S., Hanson, C., and Nishiyama, Y. (2003) J. Biol. Chem. 278, 20429–20435[Abstract/Free Full Text]
- Oleksyszyn, J., and Powers, J. C. (1994) Methods Enzymol. 244, 423–441[Medline]
[Order article via Infotrieve]
- Bertrand, J. A., Oleksyszyn, J., Kam, C. M., Boduszek, B., Presnell, S., Plaskon, R. R., Suddath, F. L., Powers, J. C., and Williams, L. D. (1996) Biochemistry 35, 3147–3155[CrossRef][Medline]
[Order article via Infotrieve]
- Paul, S., Volle, D. J., Beach, C. M., Johnson, D. R., Powell, M. J., and Massey, R. J. (1989) Science 244, 1158–1162[Abstract/Free Full Text]
- Gao, Q. S., Sun, M., Rees, A. R., and Paul, S. (1995) J. Mol. Biol. 253, 658–664[CrossRef][Medline]
[Order article via Infotrieve]
- Ramsland, P. A., Terzyan, S. S., Cloud, G., Bourne, C. R., Farrugia, W., Tribbick, G., Geysen, H. M., Moomaw, C. R., Slaughter, C. A., and Edmundson, A. B. (2006) Biochem. J. 395, 473–481[CrossRef][Medline]
[Order article via Infotrieve]
- Pratt, K. P., Shen, B. W., Takeshima, K., Davie, E. W., Fujikawa, K., and Stoddard, B. L. (1999) Nature 402, 439–442[CrossRef][Medline]
[Order article via Infotrieve]
- Planque, S., Bangale, Y., Song, X. T., Karle, S., Taguchi, H., Poindexter, B., Bick, R., Edmundson, A., Nishiyama, Y., and Paul, S. (2004) J. Biol. Chem. 279, 14024–14032[Abstract/Free Full Text]
- Kasper, C. K., and Pool, J. G. (1975) Thromb. Diath. Haemorrh. 34, 875–876[Medline]
[Order article via Infotrieve]
- Paul, S., Said, S. I., Thompson, A. B., Volle, D. J., Agrawal, D. K., Foda, H., and de la Rocha, S. (1989) J. Neuroimmunol. 23, 133–142[CrossRef][Medline]
[Order article via Infotrieve]
- Paul, S., Mei, S., Mody, B., Eklund, S. H., Beach, C. M., Massey, R. J., and Hamel, F. (1991) J. Biol. Chem. 266, 16128–16134[Abstract/Free Full Text]
- Paul, S., Sun, M., Mody, R., Tewary, H. K., Stemmer, P., Massey, R. J., Gianferrara, T., Mehrotra, S., Dreyer, T., and Meldal, M. (1992) J. Biol. Chem. 267, 13142–13145[Abstract/Free Full Text]
- Paul, S., Tramontano, A., Gololobov, G., Zhou, Y. X., Taguchi, H., Karle, S., Nishiyama, Y., Planque, S., and George, S. (2001) J. Biol. Chem. 276, 28314–28320[Abstract/Free Full Text]
- Ten Boekel, E., Bock, M., Vrielink, G. J., Liem, R., Hendriks, H., and Kieviet, W. D. (2007) Thromb. Res. 12, 361–367
- Bhopale, G. M., and Nanda, R. K. (2003) J. Biosci. 28, 783–789[CrossRef][Medline]
[Order article via Infotrieve]
- Nishiyama, Y., Mitsuda, Y., Taguchi, H., Planque, S., Hara, M., Karle, S., Hanson, C. V., Uda, T., and Paul, S. (2005) J. Mol. Recognit. 18, 295–306[CrossRef][Medline]
[Order article via Infotrieve]
- Saenko, E. L., Shima, M., Gilbert, G. E., and Scandella, D. (1996) J. Biol. Chem. 271, 27424–27431[Abstract/Free Full Text]
- Nishiyama, Y., Karle, S., Mitsuda, Y., Taguchi, H., Planque, S., Salas, M., Hanson, C., and Paul, S. (2006) J. Mol. Recognit. 19, 423–431[CrossRef][Medline]
[Order article via Infotrieve]
- Schenone, M., Furie, B. C., and Furie, B. (2004) Curr. Opin. Hematol. 11, 272–277[CrossRef][Medline]
[Order article via Infotrieve]
- Nogami, K., Shima, M., Nakai, H., Tanaka, I., Suzuki, H., Morichika, S., Shibata, M., Saenko, E. L., Scandella, D., Giddings, J. C., and Yoshioka, A. (1999) Br. J. Haematol. 107, 196–203[CrossRef][Medline]
[Order article via Infotrieve]
- Healey, J. F., Lubin, I. M., Nakai, H., Saenko, E. L., Hoyer, L. W., Scandella, D., and Lollar, P. (1995) J. Biol. Chem. 270, 14505–14509[Abstract/Free Full Text]
- Zhong, D., Saenko, E. L., Shima, M., Felch, M., and Scandella, D. (1998) Blood 92, 136–142[Abstract/Free Full Text]
- Walter, J., and Bode, W. (1983) Hoppe-Seyler's Z. Physiol. Chem. 364, 949–959[Medline]
[Order article via Infotrieve]
- Biemel, K. M., Friedl, D. A., and Lederer, M. O. (2002) J. Biol. Chem. 277, 24907–24915[Abstract/Free Full Text]
- Tsao, M. L., Tian, F., and Schultz, P. G. (2005) ChemBioChem 6, 2147–2149[CrossRef][Medline]
[Order article via Infotrieve]
- van Dijk, K., van der Bom, J. G., Lenting, P. J., de Groot, P. G., Mauser-Bunschoten, E. P., Roosendaal, G., Grobbee, D. E., and van den Berg, H. M. (2005) Haematologica 90, 494–498[Abstract/Free Full Text]
- Carter, P., and Wells, J. A. (1988) Nature 332, 564–568[CrossRef][Medline]
[Order article via Infotrieve]
- Prescott, R., Nakai, H., Saenko, E. L., Scharrer, I., Nilsson, I. M., Humphries, J. E., Hurst, D., Bray, G., and Scandella, D. (1997) Blood 89, 3663–3671[Abstract/Free Full Text]
- Shetty, S., Ghosh, K., and Mohanty, D. (2003) Haemophilia 9, 654[CrossRef][Medline]
[Order article via Infotrieve]
- Sahud, M. A., Pratt, K. P., Zhukov, O., Qu, K., and Thompson, A. R. (2007) Haemophilia 13, 317–322[CrossRef][Medline]
[Order article via Infotrieve]
- Appel, S. H., Almon, R. R., and Levy, N. (1975) N. Engl. J. Med. 293, 760–761[Medline]
[Order article via Infotrieve]
- Coopamah, M. D., Garvey, M. B., Freedman, J., and Semple, J. W. (2003) Transfus. Med. Rev. 17, 69–80[CrossRef][Medline]
[Order article via Infotrieve]
- Nossal, G. J. (1997) CIBA Found. Symp. 204, 220–230[Medline]
[Order article via Infotrieve]
- Goodnow, C. C., Crosbie, J., Adelstein, S., Lavoie, T. B., Smith-Gill, S. J., Brink, R. A., Pritchard-Briscoe, H., Wotherspoon, J. S., Loblay, R. H., Raphael, K., Trent, R. J., and Basten, A. (1988) Nature 334, 676–682[CrossRef][Medline]
[Order article via Infotrieve]
- Smith, K. C., Planque, S., Bangale, Y., Nishiyama, Y., Taguchi, H., Escobar, E. A., and Paul, S. (2007) J. Immunol. 178, 88.14 (abstr.)

CiteULike Complore Connotea Del.icio.us Digg Reddit Technorati What's this?
Copyright © 2008 by the American Society for Biochemistry and Molecular Biology.
|
Advertisement
Advertisement
|