Introduction
- Henshall S.M.
- Afar D.E.
- Rasiah K.K.
- Horvath L.G.
- Gish K.
- Caras I.
- Ramakrishnan V.
- Wong M.
- Jeffry U.
- Kench J.G.
- Quinn D.I.
- Turner J.J.
- Delprado W.
- Lee C.S.
- Golovsky D.
- et al.
Results
ZNT1 is N-glycosylated on the Asn299 residue, which neither affects the ability to confer resistance against high zinc levels nor the subcellular localization of ZNT1

Characterization of endogenous ZNT1 in cultured human cells

Zinc-induced ZNT1 accumulation on the cell surface

ZNT1 accumulated on the cell surface is endocytosed and degraded in the proteasomal or lysosomal pathways under zinc deficiency

N-Glycosylation at Asn299 is involved in ZNT1 degradation

Discussion
- Hashimoto A.
- Nakagawa M.
- Tsujimura N.
- Miyazaki S.
- Kizu K.
- Goto T.
- Komatsu Y.
- Matsunaga A.
- Shirakawa H.
- Narita H.
- Kambe T.
- Komai M.
Ortholog | Amino acid sequence | Species |
---|---|---|
ZNT1 | 259SVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLD317 | Homo sapiens |
Znt1 | 254SVIVVVNALVFYFNWKGCTEDDFCTNPCFPDPCKSSVEIINSTQAPMRDAGPCWVLYLD312 | Mus musculus |
Znt1 | 244SVIVVVNALVFYFSWRGCPEGEFCVNPCIPDPCKAFVEIINSTHATVHEAGPCWVLYLD302 | Canis lupus familiaris |
Znt1 | 261SVIVVVNALLFYGLWNPCPKDGPCFNPCVNSHCVENATLSQPLGSANKSEQESITVAGPCWLLYLD326 | Gallus gallus |
Znt1 | 247SVIVVINAIIFVFVWKPCEPGTICENPCSGQHCADHALNISSPLTNGTLIKAGPCWVLYLD307 | Danio rerio |
Cdf-1 | 357SVIVMISAGFVYFL–––––––––––––––––––––––––––––––––––––––PTWKIAAYLD380 | Caenorhabditis elegans |
Znt63C | 211SIIVVISAVVVWKTEWK–––––––––––––––––––––––––––––––––––––––YRYYMD233 | Drosophila melanogaster |
- Hashimoto A.
- Nakagawa M.
- Tsujimura N.
- Miyazaki S.
- Kizu K.
- Goto T.
- Komatsu Y.
- Matsunaga A.
- Shirakawa H.
- Narita H.
- Kambe T.
- Komai M.
Experimental procedures
Cell culture
Plasmid construction
Disruption of ZNT1 genes in HAP1 and PANC1 cells
Immunoblotting
Cell surface biotinylation assay
PNGase F digestion
Immunofluorescence staining
Cytotoxicity assay against high zinc concentrations
Reverse transcription-quantitative PCR (RT-qPCR)
Statistical analyses
Author contributions
Acknowledgments
Supplementary Material
References
- Physiological roles of zinc transporters: molecular and genetic importance in zinc homeostasis.J. Physiol. Sci. 2017; 67 (28130681): 283-301
- The physiological, biochemical, and molecular roles of zinc transporters in zinc homeostasis and metabolism.Physiol. Rev. 2015; 95 (26084690): 749-784
- Mammalian zinc transporters: nutritional and physiologic regulation.Annu. Rev. Nutr. 2009; 29 (19400752): 153-176
- Cloning and functional characterization of a mammalian zinc transporter that confers resistance to zinc.EMBO J. 1995; 14 (7882967): 639-649
- Regulation of the zinc transporter ZnT-1 by dietary zinc.Proc. Natl. Acad. Sci. U.S.A. 1998; 95 (9560190): 4841-4846
- Immunohistochemical analysis of ZnT1, 4, 5, 6, and 7 in the mouse gastrointestinal tract.J. Histochem. Cytochem. 2007; 55 (17101726): 223-234
- A subclass of serum anti-ZnT8 antibodies directed to the surface of live pancreatic beta-cells.J. Biol. Chem. 2018; 293 (29184000): 579-587
- Coupling of insulin secretion and display of a granule-resident zinc transporter ZnT8 on the surface of pancreatic beta cells.J. Biol. Chem. 2017; 292 (28130446): 4034-4043
- Expression of the zinc transporter ZnT4 is decreased in the progression from early prostate disease to invasive prostate cancer.Oncogene. 2003; 22 (12955079): 6005-6012
- Mammalian zinc transport, trafficking, and signals.J. Biol. Chem. 2006; 281 (16793761): 24085-24089
- Efflux and compartmentalization of zinc by members of the SLC30 family of solute carriers.Pflugers Arch. 2004; 447 (12748859): 744-751
- ZnT-1 expression in astroglial cells protects against zinc toxicity and slows the accumulation of intracellular zinc.Glia. 2004; 48 (15378655): 145-155
- Protection against zinc toxicity by metallothionein and zinc transporter 1.Proc. Natl. Acad. Sci. U.S.A. 2004; 101 (15041749): 4918-4923
- Expression of zinc transporter gene, ZnT-1, is induced after transient forebrain ischemia in the gerbil.J. Neurosci. 1997; 17 (9254680): 6678-6684
- Zinc transporter-1 concentrates at the postsynaptic density of hippocampal synapses.Mol. Brain. 2014; 7 (24602382): 16
- Cation diffusion facilitator proteins modulate Raf-1 activity.J. Biol. Chem. 2004; 279 (15096503): 27807-27815
- ZnT-1 protects HL-1 cells from simulated ischemia-reperfusion through activation of Ras-ERK signaling.J. Mol Med. (Berl). 2012; 90 (22193398): 127-138
- Zinc ions and cation diffusion facilitator proteins regulate Ras-mediated signaling.Dev. Cell. 2002; 2 (12015965): 567-578
- Mouse zinc transporter 1 gene provides an essential function during early embryonic development.Genesis. 2004; 40 (15452870): 74-81
- Hepcidin attenuates zinc efflux in Caco-2 cells.J. Nutr. 2016; 146 (27655758): 2167-2173
- Molecular basis for zinc transporter 1 action as an endogenous inhibitor of L-type calcium channels.J. Biol. Chem. 2009; 284 (19767393): 32434-32443
- Regulation of cellular zinc balance as a potential mechanism of EVER-mediated protection against pathogenesis by cutaneous oncogenic human papillomaviruses.J. Exp. Med. 2008; 205 (18158319): 35-42
- The transcription factor MTF-1 mediates metal regulation of the mouse ZnT1 gene.J. Biol. Chem. 2000; 275 (10952993): 34803-34809
- Zinc-induced formation of a coactivator complex containing the zinc-sensing transcription factor MTF-1, p300/CBP, and Sp1.Mol. Cell Biol. 2008; 28 (18458062): 4275-4284
- Zinc sensing by metal-responsive transcription factor 1 (MTF1) controls metallothionein and ZnT1 expression to buffer the sensitivity of the transcriptome response to zinc.Metallomics. 2016; 8 (26824222): 337-343
- Direct comparison of manganese detoxification/efflux proteins and molecular characterization of ZnT10 as a manganese transporter.J. Biol. Chem. 2016; 291 (27226609): 14773-14787
- Cooperative functions of ZnT1, metallothionein and ZnT4 in the cytoplasm are required for full activation of TNAP in the early secretory pathway.PLoS ONE. 2013; 8 (24204829): e77445
- Sequence similarity and functional relationship among eukaryotic ZIP and CDF transporters.Genomics Proteomics Bioinformatics. 2006; 4 (16689696): 1-9
- Evaluation of the roles of the cytosolic N-terminus and His-rich loop of ZNT proteins using ZNT2 and ZNT3 chimeric mutants.Sci. Rep. 2018; 8 (30237557): 14084
- Differential regulation of zinc transporter 1, 2, and 4 mRNA expression by dietary zinc in rats.J. Nutr. 2001; 131 (11208937): 46-52
- Understanding the mechanisms of zinc-sensing by metal-response element binding transcription factor-1 (MTF-1).Arch. Biochem. Biophys. 2007; 463 (17462582): 201-210
- Zinc'ing sensibly: controlling zinc homeostasis at the transcriptional level.Metallomics. 2014; 6 (24722954): 1198-1215
- The effects of transformation and ZnT-1 silencing on zinc homeostasis in cultured cells.J. Nutr. Biochem. 2012; 23 (21775119): 629-634
- Ligand-regulated transport of the Menkes copper P-type ATPase efflux pump from the Golgi apparatus to the plasma membrane: a novel mechanism of regulated trafficking.EMBO J. 1996; 15 (8947031): 6084-6095
- ATP7A trafficking and mechanisms underlying the distal motor neuropathy induced by mutations in ATP7A.Ann. N.Y. Acad. Sci. 2014; 1314 (24754450): 49-54
- Copper-regulated trafficking of the Menkes disease copper ATPase is associated with formation of a phosphorylated catalytic intermediate.J. Biol. Chem. 2002; 277 (12228238): 46736-46742
- Characterization of ATP7A missense mutants suggests a correlation between intracellular trafficking and severity of Menkes disease.Sci. Rep. 2017; 7 (28389643): 757
- Zinc transporters and cancer: a potential role for ZIP7 as a hub for tyrosine kinase activation.Trends Mol. Med. 2009; 15 (19246244): 101-111
- Novel proteolytic processing of the ectodomain of the zinc transporter ZIP4 (SLC39A4) during zinc deficiency is inhibited by acrodermatitis enteropathica mutations.Mol. Cell Biol. 2009; 29 (18936158): 129-139
- Properties of Zip4 accumulation during zinc deficiency and its usefulness to evaluate zinc status: a study of the effects of zinc deficiency during lactation.Am. J. Physiol. Regul. Integr. Comp. Physiol. 2016; 310 (26702153): R459-R468
- Zinc transporter-2 (ZnT2) variants are localized to distinct subcellular compartments and functionally transport zinc.Biochem. J. 2009; 422 (19496757): 43-52
- An iron-regulated and glycosylation-dependent proteasomal degradation pathway for the plasma membrane metal transporter ZIP14.Proc. Natl. Acad. Sci. U.S.A. 2014; 111 (24927598): 9175-9180
- Soybean extracts increase cell surface ZIP4 abundance and cellular zinc levels: a potential novel strategy to enhance zinc absorption by ZIP4 targeting.Biochem. J. 2015; 472 (26385990): 183-193
- Novel zinc-responsive post-transcriptional mechanisms reciprocally regulate expression of the mouse Slc39a4 and Slc39a5 zinc transporters (Zip4 and Zip5).Biol. Chem. 2007; 388 (18020946): 1301-1312
- The acrodermatitis enteropathica gene ZIP4 encodes a tissue-specific, zinc-regulated zinc transporter in mice.J. Biol. Chem. 2003; 278 (12801924): 33474-33481
- A histidine-rich cluster mediates the ubiquitination and degradation of the human zinc transporter, hZIP4, and protects against zinc cytotoxicity.J. Biol. Chem. 2007; 282 (17202136): 6992-7000
- Identification of SLC39A4, a gene involved in acrodermatitis enteropathica.Nat. Genet. 2002; 31 (12068297): 239-240
- A novel member of a zinc transporter family is defective in acrodermatitis enteropathica.Am. J. Hum. Genet. 2002; 71 (12032886): 66-73
- A mouse model of acrodermatitis enteropathica: loss of intestine zinc transporter ZIP4 (Slc39a4) disrupts the stem cell niche and intestine integrity.PLoS Genet. 2012; 8 (22737083): e1002766
- Absorption mechanisms of iron, copper, and zinc: an overview.J. Nutr. Sci. Vitaminol. (Tokyo). 2018; 64 (29491267): 1-7
- O-Linked glycosylation at threonine 27 protects the copper transporter hCTR1 from proteolytic cleavage in mammalian cells.J. Biol. Chem. 2007; 282 (17525160): 20376-20387
- Zinc deficiency causes delayed ATP clearance and adenosine generation in rats and cell culture models.Commun. Biol. 2018; 1 (30271993): 113
- Functional domains of NEAT1 architectural lncRNA induce paraspeckle assembly through phase separation.Mol. Cell. 2018; 70 (29932899): 1038-1053.e7
- Tissue nonspecific alkaline phosphatase is activated via a two-step mechanism by zinc transport complexes in the early secretory pathway.J. Biol. Chem. 2011; 286 (21402707): 16363-16373
- Differential regulation of zinc efflux transporters ZnT-1, ZnT-5 and ZnT-7 gene expression by zinc levels: a real-time RT-PCR study.Biochem. Pharmacol. 2004; 68 (15276077): 699-709
- The PP-motif in luminal loop 2 of ZnT transporters plays a pivotal role in TNAP activation.Biochem. J. 2016; 473 (27303047): 2611-2621
Article info
Publication history
Footnotes
This work was supported by a Grant-in-Aid for Scientific Research on Innovative Areas “Bio-metal” KAKENHI Grant 19H05768 (to T. K.) from the Ministry of Education, Culture, Sports, Science, and Technology, Japan, Grant-in-Aid for Scientific Research (B) KAKENHI Grants 15H04501 and 19H02883 (to T. K.) from the Japan Society for the Promotion of Science (to T. K.), a Grant-in-Aid for JSPS Research Fellow KAKENHI Grant 17J09455 (to Y. N.), and grants from the Fuji Foundation for Protein Research, Ito Foundation, Sugiyama Chemical & Industrial Laboratory, Kao Melanin Workshop, and the Cosmetology Research Foundation (to T. K.). The authors declare that they have no conflicts of interest with the contents of this article.
This article contains Fig. S1 and Tables S1 and S2.
The amino acid sequence of this protein can be accessed through the DNA Databank of Japan under accession number BBM28213.1.
Identification
Copyright
User license
Creative Commons Attribution (CC BY 4.0) |
Permitted
- Read, print & download
- Redistribute or republish the final article
- Text & data mine
- Translate the article
- Reuse portions or extracts from the article in other works
- Sell or re-use for commercial purposes
Elsevier's open access license policy